KEGG   Heliobacterium modesticaldum: HM1_0896Help
Entry
HM1_0896          CDS       T00653                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hmo  Heliobacterium modesticaldum
Pathway
hmo00071  Fatty acid degradation
hmo00280  Valine, leucine and isoleucine degradation
hmo00362  Benzoate degradation
hmo00620  Pyruvate metabolism
hmo00630  Glyoxylate and dicarboxylate metabolism
hmo00640  Propanoate metabolism
hmo00650  Butanoate metabolism
hmo00900  Terpenoid backbone biosynthesis
hmo01100  Metabolic pathways
hmo01110  Biosynthesis of secondary metabolites
hmo01120  Microbial metabolism in diverse environments
hmo01130  Biosynthesis of antibiotics
hmo01200  Carbon metabolism
hmo01212  Fatty acid metabolism
hmo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HM1_0896
   00630 Glyoxylate and dicarboxylate metabolism
    HM1_0896
   00640 Propanoate metabolism
    HM1_0896
   00650 Butanoate metabolism
    HM1_0896
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HM1_0896
   00072 Synthesis and degradation of ketone bodies
    HM1_0896
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HM1_0896
   00310 Lysine degradation
    HM1_0896
   00380 Tryptophan metabolism
    HM1_0896
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HM1_0896
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HM1_0896
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HM1_0896
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hmo04147]
    HM1_0896
Enzymes [BR:hmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HM1_0896
Exosome [BR:hmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HM1_0896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD
Motif
Other DBs
NCBI-ProteinID: ABZ83669
UniProt: B0TAL7
Position
1101059..1102240
Genome map
AA seq 393 aa AA seqDB search
MLREVVFVSAVRTPFGKFGGAMASLKAVDLGAAAIQGALRQGGVEPEMVEYVTMGQVLQG
GAGQIPSRQAARLAGIPWETPSLTVNKVCASGMIAVALAARMIAAGEIEAAVAGGMESMS
QAPYFLPAARWGQRMFNFEAVDLMVHDGLWCPFYNRHMALHGADMAREYGVSREEQDEWA
LRSQERAAAAIAGGYMAEEIVPVTVPQKKGAPTVVSQDEQPRPTTREGLAKLAPIFDPQG
TITAGNAPSVNDGAGALLLMSREKAESLGIRPLATLIGHTEVALEARELAAAPGHAINRL
LAKTGKRLDQVDLFEVNEAFAAVVLVSQKVAGFDLEKVNINGGAVAFGHPIGASGARIIA
TLIHSLRRKGGGIGMAAICSGAAQGDALMVRVD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
ttgttgcgtgaagtggtatttgtcagcgcagtccggacgccctttggcaagttcggcggt
gctatggcttccttgaaggccgtcgacctgggtgctgctgccattcagggcgccttgcgg
caaggcggtgtcgaaccggagatggtggagtatgtcaccatgggacaggtgctccaaggc
ggcgccggtcagatcccatcccgccaggcggcacgcttggcaggtattccttgggagacg
ccttctttgacggtcaataaggtctgcgccagcggcatgatcgctgtcgccttggctgcg
cggatgatcgccgcaggcgagatcgaggcagcagtcgccggcggcatggagagcatgagc
caagcgccttatttcctcccggcggcacgctggggacagcgcatgttcaacttcgaggct
gtcgacttgatggttcatgacgggctctggtgtcccttttacaaccgccatatggctctg
cacggtgctgacatggcccgtgagtatggcgtcagccgcgaagagcaggatgaatgggct
ttgcgcagccaagaacgggcggcggccgccatcgccggcggttacatggcagaggagatc
gtgccggtgacggtacctcagaaaaaaggtgcgccgacggtggtcagtcaagatgagcag
cctcggcccaccacccgagagggattggcgaaattggcgcccatcttcgatccccagggg
acgatcacagccggcaacgcgcctagcgtcaacgacggcgccggcgcgctcctcttgatg
agccgggaaaaagcggagtcactaggaattcgtcctctggccaccttaatcggccataca
gaagtggccctcgaagcgagggagcttgccgccgcaccgggtcacgccatcaaccgtctg
ctggccaagacgggaaaaagactggatcaggttgacctctttgaggtcaatgaggccttt
gccgccgttgttctcgtcagccagaaagtggccggctttgacctggaaaaagtcaatatc
aacggcggcgctgtcgccttcggccaccccatcggcgccagcggcgcccgcatcatcgcc
accctcattcacagcttgcgccggaaaggcggcggcatcggcatggcagcgatctgcagc
ggcgctgcccaaggggatgcgctcatggtgcgtgtcgattga

DBGET integrated database retrieval system