KEGG   Heliobacterium modesticaldum: HM1_1115Help
Entry
HM1_1115          CDS       T00653                                 

Gene name
galU
Definition
(GenBank) utp-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hmo  Heliobacterium modesticaldum
Pathway
hmo00040  Pentose and glucuronate interconversions
hmo00052  Galactose metabolism
hmo00500  Starch and sucrose metabolism
hmo00520  Amino sugar and nucleotide sugar metabolism
hmo01100  Metabolic pathways
hmo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hmo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HM1_1115 (galU)
   00052 Galactose metabolism
    HM1_1115 (galU)
   00500 Starch and sucrose metabolism
    HM1_1115 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HM1_1115 (galU)
Enzymes [BR:hmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HM1_1115 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: ABZ83459
UniProt: B0THM1
Position
complement(875443..876333)
Genome map
AA seq 296 aa AA seqDB search
MHKKVRKAIIPAAGLGTRFLPATKAQPKEMLPIIDKPTIQFIIEEAIAAGIEDILIVTGR
NKRAIEDHFDRSVELEVFLEERGKWELLESVRQIGSLADIHYVRQKEPLGLGHAIYCARS
FIGQEPFAVLLGDDVIHANRPCIGQLIEAYHQVRGTVVGVQPVPREHSRRYGMVSLAAEA
GTNLWKLDAIVEKPEPEKAPSDLAVMGRYVIEPEVFCILENQAPGKGGEIQLTDALHALH
AECDKGLFAYLFEGIRYDVGDRIGYLKATVDYALRRDDLAEEFTAYLQEVLQRRER
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgcacaaaaaggttcgcaaagcgatcatccccgccgccgggttggggacgcgcttttta
ccggccaccaaagcccagccgaaagagatgctgcccatcatcgacaagccgacgatccag
ttcatcatcgaagaagccatcgccgccggcatcgaagacatcctgatcgtcaccggccgg
aacaaacgggccatcgaggatcatttcgaccgctccgtagaattggaggtcttcttggaa
gagcggggaaaatgggagctcctcgagtcggtcaggcagatcggcagcctggccgacatc
cactatgtccgtcaaaaagaaccgctcgggctcggccatgccatctactgcgcccgttcc
ttcatcggtcaggagccctttgccgttctcttgggcgatgacgtgattcatgccaacaga
ccctgcatcggccagctgatcgaggcctaccatcaggtgcggggcactgtcgtaggggtg
cagcctgtccccagggagcacagccgccgctacgggatggtttctctcgccgcagaagcg
ggtacaaacctgtggaagctggacgccattgtggaaaagccggaaccggagaaggcgcct
tccgatctggccgtcatgggacggtatgtcatcgagccggaggtcttctgcatcctggaa
aaccaggcgccgggcaaaggcggcgagatccaactgaccgacgccttgcacgccctccac
gccgaatgcgacaaggggcttttcgcctacctgtttgaagggatccgctacgatgtgggt
gatcggatcggctacctgaaggcgaccgtcgattatgccttgcggcgggacgacctggcc
gaagagtttaccgcctatctgcaggaggtcttgcagcgccgggagaggtga

DBGET integrated database retrieval system