KEGG   Heliobacterium modesticaldum: HM1_1448Help
Entry
HM1_1448          CDS       T00653                                 

Definition
(GenBank) acetyl-CoA hydrolase, putative
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
hmo  Heliobacterium modesticaldum
Pathway
hmo00020  Citrate cycle (TCA cycle)
hmo00620  Pyruvate metabolism
hmo00650  Butanoate metabolism
hmo01100  Metabolic pathways
hmo01110  Biosynthesis of secondary metabolites
hmo01120  Microbial metabolism in diverse environments
hmo01130  Biosynthesis of antibiotics
hmo01200  Carbon metabolism
Module
hmo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HM1_1448
   00620 Pyruvate metabolism
    HM1_1448
   00650 Butanoate metabolism
    HM1_1448
Enzymes [BR:hmo01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     HM1_1448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans
Motif
Other DBs
NCBI-ProteinID: ABZ84021
UniProt: B0TCJ5
Position
complement(1462919..1464415)
Genome map
AA seq 498 aa AA seqDB search
MLSQRLRNAALRERIVTAEEAASWIEDGMTLGFSGFTAAGDVKVIPLALVERVKKIGKPF
KVNVYTGASISAHIDGILAESGIVHRRLPYQSEKRMRAALNNGDVCYVDQHLSHTAELLR
SGAIPPVDVALIEAVAITEEGHLIPSTSVGNTHIFVAQAKEVIVELNVAQPLALEGIHDI
YDPGYQGHRQPIPLTQVGQRIGMTAIPVDPAKIRGIVITNQADVNSAIAPPDDETERMAQ
HLLNFLKDEVSAGRLGPNLAPLQSGVGSIANAVFAGFLNSDFSDLEIYSEVLQDSVFQLL
DANKVKMASGCSFTLSPETHKHVMANLDKYRDKLVLRPQEISNNPGLIRRLGLIAINTAL
EVDIYGHVNSTHVLGTQMMNGIGGSGDFARNARLTFFCTKSYAKKGRISSIVPMCSHVDH
TEHDVDIIVTEQGLADLRGLSPRERAKRIIENCAHPAYRPLLRAYYEEAVALGGHTPHVI
EKAHSFHARYMQTGSMME
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccaacgcttgcgcaatgccgccctgagagaacgcatcgtaactgcagaagaa
gcagcgtcctggattgaggacgggatgaccctcggctttagcggatttaccgctgccggc
gacgtcaaggtgattcccctggctttggtcgagcgtgtgaaaaagataggaaagccgttc
aaagtcaacgtctacaccggcgcttccatcagcgctcatatcgacggcatcctggctgaa
tcaggcatcgtccaccgccggctgccctaccagtcagaaaagcggatgcgtgccgctctc
aacaacggcgatgtctgctacgtagaccagcacctctcccatacggcggaactgctccgt
tccggcgccatcccgcccgtcgacgtggcccttattgaagcggtcgccatcaccgaagag
ggacacctcatcccgagcacctctgtgggcaacacccacatcttcgtcgcccaggccaaa
gaggtcatcgtcgagttgaacgtcgctcaacccctggccctggaagggattcatgacatt
tacgatcccggttaccaagggcaccgccaaccgatccctctcacccaggtgggccagcgc
atcggcatgacggcgattcctgttgacccggccaagatccgcggcatcgtcatcaccaac
caggctgatgtcaactcagccatcgccccgcccgatgatgagacggaacggatggcccag
cacctcttgaacttcctcaaggacgaagtatctgctggacgcctcggtccgaacctggca
ccgctgcaatcgggtgtcggctccatcgccaacgccgtcttcgccggcttcctcaactcc
gatttttccgatcttgagatctactcggaggtcctgcaggattcggtcttccaattgctc
gacgccaacaaggtcaagatggcttccggttgctccttcaccctctcgccggagactcac
aagcatgtcatggcaaacctggacaagtaccgcgacaagctggtgttgcgcccgcaggag
atatcgaacaatcccggcctgatccgacgcctcggcctgatcgctatcaacacggcgctg
gaagtggatatctatggccatgtcaactcgacccacgtcttgggtacccagatgatgaac
ggcatcggcggctccggcgacttcgcccgcaacgcccgcctcaccttcttctgcaccaag
tcctacgccaaaaagggcaggatctccagcatcgtgccgatgtgctcccatgtggaccat
acggaacacgacgtggacatcatcgtcaccgaacagggcctggctgacctgcgcggcctc
tccccccgggagcgggccaagcggatcatcgagaattgcgcccatcccgcctaccgcccc
ctgctgcgggcctactatgaggaagccgtcgcccttggcggccacacaccgcacgtcatc
gaaaaggcccactctttccatgcccggtacatgcagacggggtcgatgatggagtag

DBGET integrated database retrieval system