KEGG   Heliobacterium modesticaldum: HM1_1922Help
Entry
HM1_1922          CDS       T00653                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hmo  Heliobacterium modesticaldum
Pathway
hmo00260  Glycine, serine and threonine metabolism
hmo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hmo01100  Metabolic pathways
hmo01110  Biosynthesis of secondary metabolites
hmo01130  Biosynthesis of antibiotics
hmo01230  Biosynthesis of amino acids
Module
hmo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hmo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HM1_1922 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HM1_1922 (trpA)
Enzymes [BR:hmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HM1_1922 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: ABZ84480
UniProt: B0TFQ0
Position
1922215..1923030
Genome map
AA seq 271 aa AA seqDB search
MEDLRGTERLTATFANLKAEGKRAFIAYVTAGDPDLETTRELVLTLEKNGASIIELGVPF
SDPVADGPVIQEAAVRALAGGTTLTKVLAMVRTLRRETSIPIVLLTYYNPVLRFGLLRFA
REAAASGVDGVIVADLPAEEGGVLREPLDELGLALIPLVAPTSTPERIQRIAEKARGFIY
CVSLLGVTGMRSDLPPDAAALLERVRAMTDVPLALGFGISRAEHVAIVAPNCDGVIVGSA
IVKLIAQNLGDRARMLAEVGAFAREMAAAVG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggaagacctgcgtggaacagaacggttgactgcgaccttcgccaacctgaaagccgaa
ggcaagcgggccttcatcgcctatgtgacggcgggagaccctgatctggagacgacgcgg
gaactggtgctgacgctggagaagaatggcgcctcgatcatcgaactgggcgttcccttc
agcgaccctgtcgccgatgggcccgtcatccaggaggcggccgtccgggcgctggccggt
gggacgacgctgaccaaagtgctggcgatggtgcggacgctgcgccgggagacgtcgatc
cccatcgtcctcctcacttattacaacccggttctgcgcttcggccttttgcgctttgcc
cgcgaagcggcggcctccggcgtcgacggcgtcatcgtcgccgacctgccggccgaagaa
ggcggcgtgctgagagaacccctggatgagttagggttggccttgattcctctggtcgcg
cctacatcgacaccggaacgcattcaacggatcgccgaaaaggcgcgcggtttcatctac
tgcgtctcactgcttggggtgacggggatgcggtctgacctgccgcctgacgcggcagcc
ttgctggaacgggtgcgggcgatgaccgatgttcccttggctctcggcttcggcatctcc
agggcggagcatgtggcgatcgtggcgcccaactgtgacggcgtcatcgtcggcagcgcc
atcgtcaagctcatcgcccaaaacctcggtgaccgggcgagaatgctcgctgaggtgggc
gcttttgcccgagagatggcggcggctgtcggttga

DBGET integrated database retrieval system