KEGG   Hippea maritima: Hipma_0043Help
Entry
Hipma_0043        CDS       T01456                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hmr  Hippea maritima
Pathway
hmr00450  Selenocompound metabolism
hmr00970  Aminoacyl-tRNA biosynthesis
hmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hmr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Hipma_0043
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Hipma_0043
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hmr01007]
    Hipma_0043
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hmr03016]
    Hipma_0043
Enzymes [BR:hmr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Hipma_0043
Amino acid related enzymes [BR:hmr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Hipma_0043
Transfer RNA biogenesis [BR:hmr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Hipma_0043
 Prokaryotic type
   Other AARSs
    Hipma_0043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f Rad50_zn_hook DUF2935
Motif
Other DBs
NCBI-ProteinID: AEA33026
UniProt: F2LWP8
Position
44112..45977
Genome map
AA seq 621 aa AA seqDB search
MKKYYITTPIYYVNDVPHIGHSYTTLAADTLARYKRLLGEDVFFLTGTDEHGQKIQKAAK
SANTTPKQLADRVVENFKKLWKKLDITNNFFVRTTDDYHQKCVQEAFEYIYKKGDIYKGE
YEGWYCIPCESYYSEIEIGENKTCPVCGRKLDLVKEESYFFKLSAYQDRLLEFYENNPDF
VLPQTRYNEIKSFVKMGLKDLSITRTSFDWGIPVPFDDKHVIYVWFDALLNYVSAIGCRK
GDFDDIWPADVHFVGKDILRFHAVYWPAFLMALDLPLPKHVVAHGWWTVDGKKMSKSLGN
VVDPNEMIEKYPRDAYRYFLLRNVPFGLDGDFSEKELIERINSDLVNDFGNLLNRSLTMM
EKYSKGNIRRPSAINDDSLSILAKETFKKVEDSLKVFRFDEALIAIFDFIKSANKYIAQK
EPWSLKKQGKQDELDEVLYNLYASLKFISGIISPFLPDAANKMQDMLNLEKDKTVEFYLD
FYNVEEAKIKKAGMLFERIEEKKEEKEEELRDKRISIEEFFNVDLRVARVLEAENVEKSK
KLLKLKIDIGEDKPRTLVAGLKEFYKPEDLVGKLIIVVANLKPAKLMGIESNGMLLAAKD
DSGKPVILTPSETVKPGAKIS
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtactacataacaacgccgatttattacgttaacgacgtaccccatattggg
cattcttacacaacattagctgcggatacactggcaaggtacaagaggcttttgggtgag
gatgtgtttttcttgacaggtacagatgagcatggacagaagattcaaaaagcggctaaa
tctgccaacacaacgccaaagcagcttgccgatagggttgttgagaattttaaaaagcta
tggaaaaagcttgatataacaaacaatttttttgttagaactacagatgattaccatcag
aagtgcgttcaagaagcctttgaatatatctacaaaaagggtgatatatacaagggtgaa
tatgagggctggtattgtataccgtgcgagagctattattcagagattgaaataggcgag
aataaaacatgccccgtctgcggcaggaagcttgaccttgtaaaggaagagagttatttt
ttcaagctatctgcttatcaggataggttgcttgagttttacgagaacaaccctgatttt
gtcctgcctcaaacacgttataatgagataaagagctttgtcaagatggggttgaaagat
ctgagtattacaagaacgtcgtttgattggggtattcctgttccgtttgatgataaacat
gttatatatgtttggtttgatgcgcttttgaattatgtaagtgctataggttgcaggaaa
ggtgatttcgatgatatatggccggcggatgtccattttgtcggtaaggatatattgaga
tttcatgcagtttattggcctgcatttttgatggcactcgatttacccttacccaaacat
gttgtagcccacggctggtggacggttgatggcaaaaagatgagtaaatcattgggcaat
gttgtagatcctaacgagatgatagaaaaatacccccgagatgcatataggtatttcttg
ctgaggaatgtgccatttggtcttgatggtgatttttctgagaaagagctaatagagaga
ataaactcagaccttgttaacgatttcggcaacctgctaaacagaagcctgacgatgatg
gagaagtattcaaaaggcaatataaggagaccttctgctataaacgacgatagtttaagt
atacttgcaaaagagaccttcaaaaaggttgaggatagtctaaaggtatttagatttgat
gaggctttaatagcgatttttgattttatcaagagtgccaataagtacattgcacaaaaa
gagccgtggagtttgaaaaagcagggcaagcaggatgaacttgatgaggttctgtacaat
ctttatgcctctcttaaatttataagtggcattatttctccgtttttacccgatgcagca
aataaaatgcaggatatgctcaatttagaaaaagataagacagttgagttttatttggat
ttctacaatgttgaagaagctaagataaaaaaagccggaatgttgttcgagaggatagaa
gagaaaaaagaagaaaaggaagaagaattaagggataagcgtataagcatagaagagttt
tttaatgttgacttgagggtagctagggttcttgaggctgagaacgttgaaaaatcaaag
aaattgcttaaacttaaaattgatataggtgaggataaaccaagaacactggttgccggg
ctaaaggagttttataaacccgaggatttggttggcaaattgattattgttgtggcaaat
ttaaaaccggcaaagttaatgggcattgagtctaacggcatgttacttgctgccaaggac
gacagtggcaagccggttatacttacgccaagtgagactgtgaagcctggtgcaaagata
agctga

DBGET integrated database retrieval system