KEGG   Hippea maritima: Hipma_0159Help
Entry
Hipma_0159        CDS       T01456                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hmr  Hippea maritima
Pathway
hmr00010  Glycolysis / Gluconeogenesis
hmr00051  Fructose and mannose metabolism
hmr00562  Inositol phosphate metabolism
hmr01100  Metabolic pathways
hmr01110  Biosynthesis of secondary metabolites
hmr01120  Microbial metabolism in diverse environments
hmr01130  Biosynthesis of antibiotics
hmr01200  Carbon metabolism
hmr01230  Biosynthesis of amino acids
Module
hmr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hmr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hipma_0159
   00051 Fructose and mannose metabolism
    Hipma_0159
   00562 Inositol phosphate metabolism
    Hipma_0159
Enzymes [BR:hmr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Hipma_0159
Exosome [BR:hmr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Hipma_0159
  Exosomal proteins of bladder cancer cells
   Hipma_0159
  Exosomal proteins of melanoma cells
   Hipma_0159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEA33138
UniProt: F2LX80
Position
158486..159220
Genome map
AA seq 244 aa AA seqDB search
MMRNIIAANWKMHFDLDSAIQVASQMKDDLSSFGKTEIIVCPSFVFLHPLANIFNESNIK
LGAQNVYFEDKGAFTGEVSPSMLKSVGCEYVIIGHSERRHIFLESDIDIQKKVKKALEYN
LKPILCVGETLSQRKEDKAFDVVERQIISALDGVDLNKVIIAYEPVWAIGTGVAADEATV
GEMHNFLANLVEDVPILYGGSVKPENAFNLAKIDTVNGFLVGSASLDTGSLKRIIVEFEK
AKGV
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaaatataattgctgccaattggaaaatgcattttgaccttgatagtgctata
caagtggcatctcagatgaaagatgacctgagtagttttggtaaaaccgaaatcattgtt
tgtcccagttttgtgtttttacatccactggctaatatttttaatgaatctaatatcaag
ctcggcgcacaaaatgtatattttgaggataaaggagcattcaccggggaagtttcaccg
tccatgctaaaaagcgtaggctgtgaatatgtaataataggtcactctgaaagaaggcat
atatttcttgaaagtgatatagatatccagaaaaaggtaaaaaaagccttagaatacaac
cttaagcccattctttgtgtgggtgagacactctctcaaagaaaagaggacaaggcattc
gatgttgttgaaaggcagattatctcagcgcttgatggtgttgatttgaataaggtaatt
attgcatatgagcctgtttgggctattggcacaggcgttgctgctgatgaggctaccgtt
ggggagatgcacaactttttagctaatttagttgaagacgttccgattctatatggtgga
agtgtaaagccagaaaacgcctttaaccttgcaaaaatagatacagtaaatggatttttg
gttggctctgcaagtttggatacaggcagcttaaaaagaattatagtggaattcgagaaa
gcaaagggggtttga

DBGET integrated database retrieval system