KEGG   Hippea maritima: Hipma_0845Help
Entry
Hipma_0845        CDS       T01456                                 

Definition
(GenBank) Glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
hmr  Hippea maritima
Pathway
hmr00860  Porphyrin and chlorophyll metabolism
hmr01100  Metabolic pathways
hmr01110  Biosynthesis of secondary metabolites
hmr01120  Microbial metabolism in diverse environments
Module
hmr_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:hmr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hipma_0845
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hmr01007]
    Hipma_0845
Enzymes [BR:hmr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Hipma_0845
Amino acid related enzymes [BR:hmr01007]
 Aminotransferase (transaminase)
  Class III
   Hipma_0845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 DUF3517 TUSC2
Motif
Other DBs
NCBI-ProteinID: AEA33815
UniProt: F2LVN1
Position
838405..839706
Genome map
AA seq 433 aa AA seqDB search
MFDKSRELFEEAKKYIAGGVNSPVRAFKNVGRHPLFIKKAKGSKIYDEDGNEFIDYVNSW
GPAILGHADDEVINKTKDALDNGFSFGAPTILETELAKRIVRAFDSIEIVRFVNSGTEAA
MSAIRLARGFTSRDNILKFNGCYHGHSDSLLVGAGSGSSTFGIPSSKGVPVDFAKHTILA
EFNDLDGVEEIFKKHGDTIAAVIIEPVAGNMGVIKPKDGFLKGLRSICDKHGSLLIFDEV
MTGFRLTYGGAQHIYNITPDITVLGKVVGGGFPVACFGAKREIMKYLAPEGDVYQAGTLS
GNPVAMACGIATLDILKRKNPYKDLEKNTSKIVSRIMGLANQYGIPASGESIGSMFSVFF
MENKPSNYRDVQKSNLRLFTNYFIGLLERGIYIPPSQFESNFITIKHSLEDIENTLVAVE
DIFKEIASGKFYV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtttgataaaagcagggaacttttcgaagaggccaaaaaatatatagctggtggtgta
aatagtcccgttagggccttcaaaaatgtaggaagacacccactttttattaaaaaggca
aagggatccaagatttacgatgaggatggaaatgagtttattgattatgtgaacagctgg
ggacctgcaatcttgggtcatgctgatgacgaggttataaacaaaacaaaggatgcactg
gataacggatttagctttggtgcacctacaattcttgaaactgaacttgccaaaagaata
gtaagagcgtttgactctatagagattgtaaggtttgtaaactctggcacagaagcggct
atgagcgcaattaggcttgctaggggttttacaagcagagataatatactcaaatttaac
ggttgctatcatggccattctgatagcttattagttggagcaggctcaggctcaagtact
ttcggtataccatcgagtaaaggtgtacctgtagattttgcaaaacacacaattttggcc
gaatttaacgatcttgatggtgtcgaagagatatttaaaaagcatggtgatactatagcc
gcagtaataatagaacctgtagccggaaacatgggtgtaattaaacccaaagacggtttt
ctgaaaggcctaagaagtatatgtgataaacacggaagccttctaatatttgatgaggta
atgaccggttttaggctaacctacggtggagctcaacacatttacaatataacacccgac
ataacggtattaggtaaagttgttggaggaggtttccctgtagcctgctttggagcaaaa
agggaaattatgaaatatttagcccccgaaggggatgtttatcaggcagggactttaagt
ggaaatcctgttgcaatggcttgtggcatagctaccctggatatactaaagagaaaaaat
ccctacaaagacttagagaaaaacacaagcaaaatagtgtcaaggatcatgggacttgcc
aatcaatatggaataccggcaagtggtgagtctataggttcgatgtttagcgtgtttttc
atggaaaacaagccatcaaactacagggatgttcaaaagagtaacttaagactctttaca
aattattttatagggttgttagaaagggggatttacatacccccatcccaatttgaatcc
aactttataacaataaaacactcacttgaggatatagagaatacccttgttgccgtagag
gacatatttaaagagatagcaagtggcaaattttacgtatga

DBGET integrated database retrieval system