KEGG   Hippea maritima: Hipma_0897Help
Entry
Hipma_0897        CDS       T01456                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hmr  Hippea maritima
Brite
KEGG Orthology (KO) [BR:hmr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Hipma_0897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AEA33867
UniProt: F2LVT3
Position
complement(886565..887812)
Genome map
AA seq 415 aa AA seqDB search
MSPLLILLLAAAFGFYMAWNIGANDVANAMGTSVGARSLSFKQAIIVAAIFEFSGAILVG
NHVSLTVAKGIVSPFSYRYDAMVFAYGMLATLLSAALWVNMATKLGMPVSTTHSIVGGVM
GFGIVTQGFGSIEWGKVITIVLSWIVSPISGGIISFFIFLFISKKILSNEKPVIAAKRYA
PFLAFMVSMVLVFSMLYKGLKNLHLNFSFVNSLLIATAVSIVFYGIIYKIVSGIPVDTTL
PYKRRYPQVERIFAILQVITASYMAFSHGANDVANAVGPLMGAVYAKALTAHQHLSMPIW
VLSVGAVGIVAGLSMYGYKVILVVGRRITDMTPSRGFAAEFGAATTVLVCSKMGLPISTT
HTLVGSVIGVGLARGIGALNLKVLKDIIVSWLLTLPIAAALSAAIFLVLKGLFLS
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgagtccgttgttaattcttttgcttgctgctgcattcggcttttacatggcatggaat
ataggtgctaacgacgttgccaacgctatgggcacaagtgttggcgctcgcagcctgagt
tttaaacaggctataattgttgcagctatttttgagttctctggagctatattggtaggt
aatcatgttagtttgactgttgcaaagggtattgttagcccattttcctatagatacgat
gctatggtgtttgcatatggaatgcttgctacacttttgtctgctgctttatgggttaat
atggctacaaagcttggaatgcctgtatctactacccactcaattgtaggtggtgttatg
ggctttggcattgtaactcaaggttttggctcgatcgagtggggaaaggttataactatt
gttttgagctggatagtgtctccaataagtggcggcatcatatctttctttatttttcta
ttcatatcaaaaaaaatactctctaatgagaaacctgttatagcggcaaaaagatatgcg
ccatttttagcttttatggtctccatggttttggttttctccatgctttataagggtctt
aagaatctacatttaaacttctcctttgtaaactccctgctcatagctacggcagtgagt
attgtcttttacggtataatatacaagatagtttccggcataccagtggataccacccta
ccctacaaaagaagataccctcaggttgagcgtatattcgccatactgcaggttattaca
gcttcatacatggcattttcccacggtgctaacgatgttgcaaatgccgttggaccatta
atgggcgccgtttatgcaaaggctttaacagctcatcaacacctatccatgccaatttgg
gttttaagcgttggcgctgtgggtatagttgctggactttctatgtatggatataaagtt
attttggttgtaggtagaagaattacagatatgacaccatcaaggggttttgctgccgaa
tttggggccgccactactgttcttgtttgttctaaaatggggcttcccatatctacaaca
catacacttgtaggttctgtaataggtgttggacttgcaagaggtataggagccctgaat
cttaaggtgttaaaagatataatagtttcatggcttttaaccttacctatagctgctgct
ctgtctgctgctatattccttgttttaaagggcttatttttgagctaa

DBGET integrated database retrieval system