KEGG   Hippea maritima: Hipma_1051Help
Entry
Hipma_1051        CDS       T01456                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hmr  Hippea maritima
Pathway
hmr00260  Glycine, serine and threonine metabolism
hmr00750  Vitamin B6 metabolism
hmr01100  Metabolic pathways
hmr01110  Biosynthesis of secondary metabolites
hmr01120  Microbial metabolism in diverse environments
hmr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hipma_1051
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hipma_1051
Enzymes [BR:hmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hipma_1051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP DUF5314
Motif
Other DBs
NCBI-ProteinID: AEA34017
UniProt: F2LW83
Position
complement(1039681..1041048)
Genome map
AA seq 455 aa AA seqDB search
MKYKSTRGGVSDLNFTDAFLMGLATDGGLIVPQTIPNVDLDNLRDLDYNNLAFEIFRLFI
DDIPYNDLRTLIGKSYSTFDTQEVTPVVKKNGLFILELFHGPTFAFKDVALQFLGNLFEY
VLKKRNTYVNVLGATSGDTGSAAIYGLKGKENINIFILHPHNKVSKVQELQMTTVEDVNV
YNLAIEGTFDDCQAIVKSIFNDLKFKEKYHLAAVNSINWARILAQIVYYFYAYFKSGVDK
AYFSVPTGNFGDIFAGYMAKRMGLPIEKLILATNSNDILYRFVNYGDYSTGKVVKTLSPS
MDIQVASNFERYLYYLSDENSIRVKELMDEFTRTKKLKFEGDLLKKVQLDFESYRAGVED
TLATIKRFYEETGYIVDPHTAAGVFAAIKAGYRDVICLSTAHPAKFPDAIMDAIGAYPEK
PRAISELEDKNKRMWVLGNSVDEVKKFIEKKLQKG
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaagtataagagcactcgaggtggcgttagtgatttgaattttactgatgccttttta
atgggtcttgctacagatggtggtttgatagttcctcagaccattccaaatgttgacttg
gataatctaagagatttagattataacaatcttgcttttgagatatttaggctatttatt
gatgacattccatataatgatttaagaacccttattggtaagagctattcgacgtttgat
acacaagaagtgacacctgttgtaaagaagaatggcctgtttatacttgaattattccat
ggacctacatttgcctttaaagatgtagcactacagtttctgggtaacctatttgagtat
gttttaaagaaaaggaatacctatgttaatgttttgggtgctacaagtggagatacgggt
tctgctgccatatatggattaaagggcaaagaaaatataaacatatttatacttcacccg
cataataaggttagcaaggttcaagagcttcaaatgaccactgttgaagatgtaaatgta
tacaatttagccattgaaggcacttttgacgactgtcaggcgattgttaaaagcatattt
aacgatcttaagtttaaagaaaaatatcatctggctgctgtaaactcgataaattgggct
cgaattttagcccaaatcgtttactatttttatgcctactttaaaagcggcgtagataaa
gcttactttagtgttccgacaggtaattttggtgatatatttgcaggctacatggcaaaa
agaatgggtttgcctatcgaaaagcttattttggccacaaactcaaacgatatactctac
aggtttgttaattacggcgattactcaaccggtaaggtggtaaaaacactttctccgtct
atggatattcaggttgcaagcaactttgagagatatctttattatctgtctgatgaaaat
tcaattagagttaaagagctgatggatgagttcacaaggacaaaaaaacttaaatttgaa
ggtgatttgcttaaaaaggttcaattagattttgagtcatacagggccggtgttgaggat
acactcgcaacgataaaacggttttacgaagagacaggttatattgtggaccctcataca
gcagctggtgtttttgcagccattaaggctggatatcgtgatgttatatgtttatcaacc
gctcaccctgcaaagttcccagatgccattatggatgctataggtgcctatcccgaaaaa
cccagagcaatttctgagcttgaagataaaaataaacgcatgtgggtgcttggtaacagc
gttgatgaggttaagaaatttatagagaaaaaattgcaaaagggttaa

DBGET integrated database retrieval system