KEGG   Hippea maritima: Hipma_1411Help
Entry
Hipma_1411        CDS       T01456                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hmr  Hippea maritima
Pathway
hmr00071  Fatty acid degradation
hmr00280  Valine, leucine and isoleucine degradation
hmr00310  Lysine degradation
hmr00620  Pyruvate metabolism
hmr00630  Glyoxylate and dicarboxylate metabolism
hmr00640  Propanoate metabolism
hmr00650  Butanoate metabolism
hmr00900  Terpenoid backbone biosynthesis
hmr01100  Metabolic pathways
hmr01110  Biosynthesis of secondary metabolites
hmr01120  Microbial metabolism in diverse environments
hmr01130  Biosynthesis of antibiotics
hmr01200  Carbon metabolism
hmr01212  Fatty acid metabolism
hmr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Hipma_1411
   00630 Glyoxylate and dicarboxylate metabolism
    Hipma_1411
   00640 Propanoate metabolism
    Hipma_1411
   00650 Butanoate metabolism
    Hipma_1411
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Hipma_1411
   00072 Synthesis and degradation of ketone bodies
    Hipma_1411
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Hipma_1411
   00310 Lysine degradation
    Hipma_1411
   00380 Tryptophan metabolism
    Hipma_1411
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Hipma_1411
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Hipma_1411
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Hipma_1411
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hmr04147]
    Hipma_1411
Enzymes [BR:hmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Hipma_1411
Exosome [BR:hmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Hipma_1411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AEA34367
UniProt: F2LY44
Position
1394818..1395993
Genome map
AA seq 391 aa AA seqDB search
MSDVFIVEALRTPFGGFGGKLKDIEAPALASEVIKELMKRTRLDGDSIDEIIMGEVLSAG
VGQAPARQAAIYAGLPYKVHALTINKVCGSGLKSVMLAAQSIMVGDSDLVIAGGAENMSK
GPYYLKNARFGYRMGNGEVIDGMVNDGLWDPYSNIHMGVIAENIAKKHNISREEQDEYAI
RSYKLAQKATENGILREEIVPITIKTKIGEITVDKDEDPYKVVWDKIPRLRPAFVKDGTV
TAVNSSTISDGAAFCMLASEDALKKYNLKPLAKLVAYSTNSLAPELFPEAPIGAIEKCVN
RAGLKLADIDLFEINEAFAVVVLVAIKQLGLDIEKVNVNGGAVSIGHPIGASGGRLVATL
IKQMKRQNAKYGLATLCIGGGEAVAAIFENT
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgtatttatagtggaagccttaagaactccatttggtggttttgggggaaag
ctaaaagatatagaagcgcctgcattggcaagtgaagttataaaagaactaatgaagcgt
acaaggttggacggcgatagtatcgacgagataatcatgggagaggtattaagcgctggc
gtgggacaggcaccagcaagacaagcagccatatatgcaggtctaccatacaaagttcat
gctttgacgataaacaaggtttgtggcagcggcctaaaatctgttatgttagctgcccaa
tctataatggtgggtgattcagatctggttatagctggtggtgcagaaaatatgtcaaaa
ggtccgtattatcttaaaaacgctagatttggctacagaatgggcaatggcgaagttata
gatggcatggtgaacgatggtttatgggatccttacagcaatattcacatgggtgtaatc
gccgaaaacattgcaaaaaaacacaacatatcaagagaagaacaagacgagtatgctata
aggtcctataaattagcccagaaagcaacagaaaatggtatactaagggaagagatcgtt
cctataacaatcaaaacaaaaataggtgaaattactgttgataaagatgaagacccttac
aaagttgtttgggacaaaatccccagactaagacctgcatttgtaaaagatggaactgta
actgctgtaaactcatcaactatttccgacggtgctgcattctgcatgctggcaagtgaa
gacgcgttgaaaaaatacaacctaaaaccgttggcaaaacttgtggcttattcaacaaac
agcctagcacccgaactattcccagaagcaccaataggagccatagaaaaatgtgttaac
agggctggactaaagttagccgacatagacctttttgagataaacgaggcatttgcagtc
gttgtgctggttgccattaagcagttgggattagacatagaaaaggtcaatgtaaatggt
ggtgctgtttctattggacacccgataggcgcaagtggtggcaggttggttgctacactt
ataaaacagatgaaaagacaaaacgcaaaatacggactcgctacactatgcatcggtggt
ggtgaggctgttgcagctatctttgaaaatacctaa

DBGET integrated database retrieval system