KEGG   Hippea maritima: Hipma_1506Help
Entry
Hipma_1506        CDS       T01456                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hmr  Hippea maritima
Pathway
hmr00900  Terpenoid backbone biosynthesis
hmr01100  Metabolic pathways
hmr01110  Biosynthesis of secondary metabolites
hmr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Hipma_1506
Enzymes [BR:hmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Hipma_1506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C
Motif
Other DBs
NCBI-ProteinID: AEA34462
UniProt: F2LTT6
Position
complement(1482214..1483368)
Genome map
AA seq 384 aa AA seqDB search
MQNVVVLGSTGSIGVNTLDIIRYDNNFNVIGLSCNKNVELLKKQIDEFRPSYVCVASGTD
LTHLKSLYPDVCFFEGKEGLVELIDLDEVDVVVNALVGVSGLLPSYFALKNKKKLALANK
ESLVVAGRVLRGLSYKNGIEIVPIDSEHSAIYQCLEHRDKDDVSKIILTASGGPFWDRDN
FEGVEPEDALAHPNWNMGKKITIDSATMMNKGFEIIEARWLFDIPADKIDVVIHRQSIVH
SAVEFVDGSIIAQIADHDMRIPIAYALTKPKRLDLPFKINLWGVGSLTFEKPDFKRFRTL
EFAFEALKKEDKNLGMVLNAADEVAVDEFLNGNIDFKDIFEILEVSLYKFEDKLPEDIFE
IDRDSERLKQEVLGLIRRDFGGKK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacgttgttgttttaggctcaaccggttctataggtgttaatacgcttgatata
attagatatgataataatttcaatgtcatagggctaagttgcaacaaaaatgtagagctt
ttgaaaaaacagattgatgagtttagaccatcttatgtgtgtgtggcaagtggaaccgat
ttaactcacttgaaatcgctttatcctgatgtttgcttctttgaaggtaaggaggggctt
gttgaacttattgatttagacgaagttgatgttgtagttaatgcccttgtcggtgtttct
ggccttcttccaagttattttgcgttaaagaacaaaaagaaacttgcccttgcaaataag
gagagcttggttgttgccggtagggttttgaggggtttatcatataaaaatggaattgag
atagtgccgatagattctgagcattcagctatttatcaatgcttggagcatagggataag
gatgatgtctctaaaattatactcacggcaagtgggggtccgttttgggatagggataat
tttgaaggtgttgagcctgaggatgcattggctcacccaaactggaatatgggcaaaaag
ataacaatagattcagctactatgatgaacaagggatttgaaataatagaagccaggtgg
ctgtttgatattccagcagataaaatagatgttgtgattcataggcaaagcatagttcat
tcggctgttgaatttgtagatggctctattatagctcaaattgcagaccatgatatgaga
atacccatagcctacgctttaacaaagcccaaaagattagatctaccgtttaagataaac
ttatggggggtgggttctttaacctttgaaaagcccgattttaagaggtttagaactctt
gagtttgcttttgaggctttaaaaaaagaagacaaaaaccttggaatggtgcttaatgct
gccgatgaggttgcggtggatgagtttttaaatggcaatatagattttaaggatatattt
gagattttggaggtttcgttgtataaatttgaagataagctgcccgaggatatatttgaa
attgatagagactcagaaaggttaaagcaagaggtgcttgggctaattagaagagatttt
ggaggaaagaaatga

DBGET integrated database retrieval system