KEGG   Hippea maritima: Hipma_1563Help
Entry
Hipma_1563        CDS       T01456                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hmr  Hippea maritima
Pathway
hmr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hmr01100  Metabolic pathways
hmr01110  Biosynthesis of secondary metabolites
hmr01130  Biosynthesis of antibiotics
hmr01230  Biosynthesis of amino acids
Module
hmr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hipma_1563
Enzymes [BR:hmr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Hipma_1563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NMO NeuB
Motif
Other DBs
NCBI-ProteinID: AEA34519
UniProt: F2LU56
Position
1539817..1540551
Genome map
AA seq 244 aa AA seqDB search
MGVLQDILKTKKAEIEKLTPKGKRNKPIFRLNDFFKENQINIIAEIKASSPSAGKIRKID
LDQILKTYSKYAKAISVLTDKTFFGGSFELLRDVADATKLPVLCKDFIIDKKQIDAAYIN
GADLVLLIVRVLDDEKLEELYSYAHKLGLDCLIEVHKEEELDRIKDLKPKIVGVNSRDLD
NLKIDLSRTKKILSQIEFDAIRIAESGIKNKKDIDFLKQYCDGFLIGETLLKTQDINKAF
EELL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgggtgttcttcaggacatactaaagacaaagaaggcagagatagaaaagcttacacca
aaaggcaaaaggaacaagcccatttttagactgaatgattttttcaaagaaaaccagatc
aacatcatagcagagataaaagcatcatcaccatcagcgggcaagataagaaaaatagac
ttagaccagatactaaaaacctattcaaaatacgcaaaagcgataagcgttttaacggat
aaaacattctttggggggagctttgagcttttaagggatgtggcagatgccacgaagttg
cctgttctttgtaaggatttcataatagacaaaaaacagatagatgcagcctatataaac
ggggcagaccttgttctgttgatcgtgagggtcttggatgatgaaaaattggaagagcta
tacagttatgctcacaagttaggtttggattgtctcattgaggttcacaaagaggaagag
ttagacagaataaaggatctaaagcccaagatcgtaggcgtaaactcacgggatttagac
aacttaaagatagacctatcaagaacaaaaaagatcctgtcccagatagagttcgatgcg
atcaggatcgcagaaagcggtataaaaaacaaaaaagacatagattttcttaaacaatat
tgcgatggctttctaatcggcgaaaccttactaaaaactcaggacataaacaaagccttt
gaggagctgttatga

DBGET integrated database retrieval system