KEGG   Hippea maritima: Hipma_1565Help
Entry
Hipma_1565        CDS       T01456                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hmr  Hippea maritima
Pathway
hmr00260  Glycine, serine and threonine metabolism
hmr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hmr01100  Metabolic pathways
hmr01110  Biosynthesis of secondary metabolites
hmr01130  Biosynthesis of antibiotics
hmr01230  Biosynthesis of amino acids
Module
hmr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hipma_1565
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hipma_1565
Enzymes [BR:hmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hipma_1565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEA34521
UniProt: F2LU58
Position
1541117..1542277
Genome map
AA seq 386 aa AA seqDB search
MKGYFGLYGGQFVAETLIPALDELEEAFNSFKKNKEAKEELNRYLKDYAGRSTPLYFAKN
LTNQLGVRVYLKREDLLHSGAHKINNTLGQIMLAKFMGKRRIIAETGAGQHGVATATAAA
ILGMECVVYMGEKDAQRQRPNLLRMKLLGAEVRIVKKGSRTLKSAINEALKDWVRNIKTT
HYLIGSVVGPHPFPKIVAYFQSIIGKEARRQILLKQKSLPDAVLACVGGGSNAIGIFKGF
LKDKGVELYGIEAGGEGLELGKHSAALTAGRPGIMHGALSYLLQNEDGQVAEVHSISAGL
DYPGVGPEHSFLKDSGRVRYGVCFDNEALEAFNMLSRLEGIIPALESSHALGYLIKNRES
FVNKTVIVNLSGRGDKDLPILEGIYV
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaagggatattttggcctatacggagggcaatttgtagctgaaacactcataccggcc
ttggatgagcttgaggaggcttttaattcttttaaaaaaaacaaagaggcgaaagaggag
ttaaaccgatatctaaaggattatgcaggaaggtcaacgccactgtattttgcaaaaaac
ctaaccaatcagcttggggttagggtttatctaaaaagggaagacctgcttcattctggt
gcacacaagataaacaacaccttaggacagataatgctggcaaagtttatgggtaaaaga
cggatcatagcagaaacaggagctggtcagcacggcgttgcaacggccacagctgcagcc
atcttgggtatggagtgtgtggtttacatgggggagaaggatgctcaacgccaaaggcca
aacctgttgagaatgaaacttttaggggctgaggtaagaatagtaaaaaaaggcagcagg
accctaaaaagcgccatcaatgaagctttaaaggattgggttaggaatataaagaccaca
cactatttaataggcagcgttgttgggcctcacccgtttcctaaaatcgtagcctatttt
caatcaatcataggcaaagaggcaagaagacagatactcctaaagcaaaaaagcctccct
gatgctgttttagcctgcgttggcggtgggagcaacgcaataggcatattcaagggattc
ttaaaggataaaggcgttgagttatacggcattgaggcaggcggggagggtttggagtta
ggcaaacactcagcagccctaaccgcaggaagaccgggtattatgcatggtgcattgagc
tatcttttacaaaacgaggacggtcaggttgccgaagtccattccatctcagcaggcctt
gactatccaggcgttggacctgagcacagctttttaaaggattcaggcagggtgagatac
ggagtgtgctttgacaatgaggctttggaggcatttaacatgctgagccgccttgaaggt
attataccggcacttgagagctcgcatgctttaggatacctaataaaaaacagagaaagc
tttgtcaacaaaaccgtaatagtaaatctttccggcagaggcgataaggacttacccata
ctggagggcatttatgtgtag

DBGET integrated database retrieval system