KEGG   Helicobacter mustelae: HMU03700Help
Entry
HMU03700          CDS       T01191                                 

Definition
(GenBank) possible phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hms  Helicobacter mustelae
Brite
KEGG Orthology (KO) [BR:hms00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HMU03700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF4771 DUF3397
Motif
Other DBs
NCBI-ProteinID: CBG39632
UniProt: D3UGL1
Position
427329..428885
Genome map
AA seq 518 aa AA seqDB search
MSSKLKKRQQTQKEIQRGALVFFFILGVAFLGAQFGNIAYHPFLVIFSCVIGAYMAMNIG
ANDVANNVGPAVGSKSISMFGIIIIAAICELAGAILAGADVINTLKSGIIDPLGFHDAKV
FVLVMLSALIAGALWLHLATVIKAPVSTTHSIVGGILGAGIAGGGMEVAKWNVLLEIGAS
WVISPLLGGLIAAGFLFFIKKTITYQQDKKQAAKKIVPLLMCFMTFVFSLYLIYKGLKNV
IKIPPLGSFGISFALGLLVYIVLKPYFERKVGKLENTKDAINKLFSLPLVVAAAFLSFAH
GANDVANAIGPLAAINQMLGNLDGVSTEASIPFWIMVIGGFGIALGLALYGPRLIKTVGC
EITELNKIRAFCAAMSAAITVLIASALGLPVSSTHIAIGAIFGIGFLREYLKRRYGKMLQ
TIQDAHSTKSELDFFMEKFRKASVKRKGFMLESLKKNKQQEILLAKKQKKVLKKVYKEEL
VKRSAIKKIIASWLITVPVSAVFSALIYWILSTSKLAF
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
gtgagtagcaagctgaaaaaaagacaacaaacccaaaaagaaattcaaagaggcgcgctt
gtcttcttttttatcttgggggtggcatttttgggtgcacaatttggcaatatcgcttac
catccttttttggtgattttttcctgtgtgattggtgcgtacatggccatgaacatcggt
gccaatgatgtggccaataatgtggggcctgcagtgggttctaaatctatcagcatgttt
ggaatcattatcattgctgctatttgtgagttggcaggagcgattttggcaggagcagat
gtaattaatacgctcaaatctgggatcatcgatcctttgggatttcatgatgctaaggtt
tttgtcctagtgatgctctcagccctcattgctggtgctctatggttgcatctagccaca
gtaatcaaggctcctgtctctaccacgcattccatcgtaggcgggattttgggcgcaggg
attgctgggggtggaatggaagtggccaaatggaatgtgcttttagagattggcgcaagc
tgggtgatctcgccattgcttgggggtttgattgctgcggggtttttgttttttatcaaa
aaaaccatcacctatcaacaggataaaaagcaagctgccaaaaaaattgtccctcttttg
atgtgttttatgacctttgtctttagtctctatctgatttataaaggcctcaaaaatgtc
atcaaaatcccacctcttgggtcttttggcattagctttgccttgggcttattggtgtac
attgtgctaaagccttattttgagaggaaggttgggaagctagaaaacaccaaggatgca
ataaataagcttttttcccttcctcttgtggtagcagcggcatttttaagcttcgcacat
ggggccaatgatgtagccaatgccattggcccgcttgctgcaatcaatcaaatgctgggg
aatcttgatggggtgagtactgaggcaagcattcctttttggatcatggttattggggga
tttggcattgctctaggactagcactctatggtccaaggcttattaagactgtgggctgt
gagattactgagctcaacaaaatccgtgcattttgtgcggccatgagtgctgctatcacc
gtgcttattgcctctgctcttgggcttcctgtgagctcgactcatattgctattggggcg
atttttgggataggatttttgcgagaatatctcaaaagacgttatggaaagatgctccaa
accatacaggatgctcatagcactaagagcgaacttgatttttttatggaaaaatttcgc
aaagcaagcgtgaagcgcaagggattcatgctagagagtctcaaaaaaaataagcagcaa
gaaatcctgctagcaaaaaaacaaaaaaaggtgctgaaaaaagtctacaaagaggagtta
gtcaagcgcagtgcgatcaaaaaaatcatcgcatcctggctcatcacagtccccgtgtct
gccgtgttctcggcactcatctattggattttatccacaagtaagctcgctttttaa

DBGET integrated database retrieval system