KEGG   Helicobacter mustelae: HMU04840Help
Entry
HMU04840          CDS       T01191                                 

Definition
(GenBank) Putative arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hms  Helicobacter mustelae
Pathway
hms00220  Arginine biosynthesis
hms00330  Arginine and proline metabolism
hms01100  Metabolic pathways
hms01110  Biosynthesis of secondary metabolites
hms01130  Biosynthesis of antibiotics
hms01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hms00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    HMU04840
   00330 Arginine and proline metabolism
    HMU04840
Enzymes [BR:hms01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HMU04840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: CBG39745
UniProt: D3UGX3
Position
complement(547298..548251)
Genome map
AA seq 317 aa AA seqDB search
MILVGLEAQLGASKQGSDEGVKALIEALRPKHGELVRHMHRIAQERCILDKKFRYARSFE
DYYVFCKEILIPRMQEVFLRKEFSLILSSEHANMFGIFQALRSVHKDKKIGILYLDAHAD
IHTAYDSDSRYIHGMPLGMVLNRVRSGFNCMNQSEEEAWQELCNLGLEKGTLEIDPRHLV
YFGVRSTEQSERDVIKELQIPLFGIDSIRENMQEVVEQSKILLRDVDIIYLSLDLDIMDG
KLFTSTGVRENHGLSFKELREFLQLLLEGFKDRLSAVEVTEYNPLVGLKNEEKEVLEILK
EIIRICKDSSWGASLGD
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtgggattagaggcgcaactaggcgcatcaaaacaaggcagtgatgagggg
gtcaaggctctgatagaggctctaaggccaaagcatggagagcttgttagacatatgcac
aggattgctcaagagcgctgcattttggataaaaaatttcgatatgccaggagttttgag
gattattatgttttttgcaaggagattttgatcccgcgcatgcaagaagtatttttgcgt
aaggaattttctctcatactaagctcagagcatgccaatatgtttgggatttttcaagcc
cttagaagcgttcacaaggacaaaaaaattgggattttatatctggatgcgcatgcagat
attcacacagcctatgatagtgattctagatacatccatggcatgcccctgggaatggta
ctcaatcgcgtgcgcagcggattcaattgcatgaatcaaagcgaagaggaggcatggcag
gagctttgcaacctgggtctagaaaaggggactttggagatagatcctaggcatctggtg
tattttggagtgaggagcacagagcagagtgaaagagatgtgatcaaggaattgcaaatt
cctttgtttggcatagattctataagagaaaatatgcaagaggtggtggaacaaagcaaa
attttgctgcgggatgtggatatcatttatctaagcctagatctagacatcatggatggg
aagctcttcacatccactggtgtgcgtgagaatcatggactaagttttaaagaattaaga
gaatttctacagttgcttttggagggcttcaaagacaggcttagcgcggtggaagtgaca
gaatataatccattagtagggctaaaaaacgaagaaaaagaggtgctagaaatcctgaaa
gaaatcattaggatctgcaaagactctagctggggtgctagccttggggattag

DBGET integrated database retrieval system