KEGG   Helicobacter mustelae: HMU05400Help
Entry
HMU05400          CDS       T01191                                 

Definition
(GenBank) Putative pyruvate ferredoxin oxidoreductase
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
hms  Helicobacter mustelae
Pathway
hms00010  Glycolysis / Gluconeogenesis
hms00020  Citrate cycle (TCA cycle)
hms00620  Pyruvate metabolism
hms00640  Propanoate metabolism
hms00650  Butanoate metabolism
hms00680  Methane metabolism
hms01100  Metabolic pathways
hms01120  Microbial metabolism in diverse environments
hms01130  Biosynthesis of antibiotics
hms01200  Carbon metabolism
Module
hms_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMU05400
   00020 Citrate cycle (TCA cycle)
    HMU05400
   00620 Pyruvate metabolism
    HMU05400
   00640 Propanoate metabolism
    HMU05400
   00650 Butanoate metabolism
    HMU05400
  Energy metabolism
   00680 Methane metabolism
    HMU05400
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HMU05400
Enzymes [BR:hms01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HMU05400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: CBG39801
UniProt: D3UH29
Position
623055..623615
Genome map
AA seq 186 aa AA seqDB search
MLEIRWHSRAGQGAVTGAKGLADVVAGKGKQVQAFAFYGSAKRGTAMTAYNRVDESPILN
HEKFMQPDYVLVIDPGLPFIVDICAHEKPDTKYIITTHLSKEELLQKKPELQGKQVYTLD
CIKISLDTIGKPIPNAPMLGALMKVSKILELDYFLEAFIKLLGKKLPQKIIDANKEAIVR
AYNEVK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaattcgatggcattctcgggctggtcaaggggcagttacgggtgcaaaaggt
ttggcagatgtagtggcaggtaaggggaagcaggtacaggcctttgctttttatggttct
gccaaaagaggaacggcgatgactgcgtataatcgcgtggatgaatctcccatattaaat
cacgagaagtttatgcaaccagattatgttttggtcattgatccgggtttgccttttatc
gtagatatttgcgcccatgagaagccagatactaagtatattatcactacacatttgagc
aaggaagaattactgcaaaaaaaaccagaattgcagggcaagcaggtttataccctggat
tgcatcaaaatctctttggataccattggaaagcctatccccaatgccccaatgctaggc
gcattgatgaaggtttccaagattttggaattggattattttttggaagcgtttattaag
cttttggggaaaaagctcccgcaaaaaatcatcgatgcgaacaaagaagcgattgttcga
gcttataacgaagtaaaataa

DBGET integrated database retrieval system