KEGG   Helicobacter mustelae: HMU05660Help
Entry
HMU05660          CDS       T01191                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
hms  Helicobacter mustelae
Pathway
hms00240  Pyrimidine metabolism
hms00250  Alanine, aspartate and glutamate metabolism
hms01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hms00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HMU05660 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HMU05660 (pyrB)
Enzymes [BR:hms01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     HMU05660 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: CBG39827
UniProt: D3UH55
Position
complement(651756..652640)
Genome map
AA seq 294 aa AA seqDB search
MRHLIKTSDLEILEILEILKKANSYPKKLAKKPLEDKLIITAFFENSTRTLSSFEIAAKN
LGASVIRLDVSRSSTSKGETIGDTAANLNAMHPHAIIIRHKNAGAGEHLARYVNCPIING
GDGAHAHPTQALLDLLTIFNHFDGKVEGKRVGIVGDIKNSRVANSNIELLSRFGLEITLI
APPHFLPETTLKTTHNLKESLKNLDILISLRTQTERHDYQIYGSLQDYARDFCITKEILG
YHDLIVLHPGPVHHNIDLGDEVLKDPRCKVLDQVSNGVLIRMAVMEYCITQENP
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcgccacctcatcaaaacaagcgaccttgagattttggagattttagagattttaaaa
aaggcaaattcctatcccaaaaaattggcaaaaaaacccctagaggataagctcatcatc
actgcattttttgaaaattctacgcgcacactcagcagctttgagattgcagcaaaaaat
ctaggagcaagtgtgataaggctagatgtctcaagaagctccacgagcaagggagaaacc
atcggtgataccgctgcaaatctcaatgccatgcacccgcatgcaatcatcattcgacac
aagaatgcgggtgcgggtgagcatctcgcaagatatgtgaactgtcccatcatcaatgga
ggagatggcgcacatgctcatcctacccaggccctcctagatctactaactatctttaat
cactttgatgggaaggtggagggcaagcgcgtggggattgttggagatatcaaaaactct
cgagttgcaaatagcaatatcgaacttctctcgcgctttggactagagattactttgatt
gcacccccacattttctccctgaaaccacgctaaaaaccacacacaatctcaaagaatcc
ctcaaaaatcttgatatcctcattagccttcgcacacaaacagagcgccatgattatcaa
atctatggctccttgcaggactatgccagggatttttgcatcaccaaagaaatcctaggc
tatcatgatcttattgtattgcatccagggccggtacatcataatatcgatttaggggat
gaggtcctaaaagatcctcgctgcaaagtccttgatcaagtaagcaatggagtacttatc
cgtatggcagtgatggagtactgcatcacccaggaaaacccctag

DBGET integrated database retrieval system