KEGG   Helicobacter mustelae: HMU05750Help
Entry
HMU05750          CDS       T01191                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hms  Helicobacter mustelae
Pathway
hms00260  Glycine, serine and threonine metabolism
hms00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hms01100  Metabolic pathways
hms01110  Biosynthesis of secondary metabolites
hms01130  Biosynthesis of antibiotics
hms01230  Biosynthesis of amino acids
Module
hms_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hms00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMU05750 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMU05750 (trpA)
Enzymes [BR:hms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMU05750 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth TMP-TENI T2SS_PulS_OutS CPSase_sm_chain KfrA_N
Motif
Other DBs
NCBI-ProteinID: CBG39836
UniProt: D3UH64
Position
complement(664383..665114)
Genome map
AA seq 243 aa AA seqDB search
MNIALMGHIIGGYPSQAQSIESALGIIEGGAQYLEVQFPFSDPSADGEIIEHACNLALQN
GFKVQQGFEIIEALSKKAQILIMTYANIIFRYGIEGFLKQAKRSGAKALIIPDLPLHQDE
GLRAHAKKMGIFVIELITPNMSDARMKEITQQSNCPYLYAVARLGITGSKTTIDDALERY
IARIRKNSNQKIALGFGIQTHEQIEQIKDSVDIIVAGSYFVRQIKQNPTKQALYLHTKKL
LEG
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgcattgatgggacatatcatagggggctatcccagccaagctcaaagcatc
gaatctgctcttggcatcattgagggaggggcacaatatctagaagtccaattccccttt
tctgaccccagcgctgatggagagattattgagcacgcatgcaatctcgcgctacaaaat
ggcttcaaagtgcaacaggggtttgaaatcatagaagcgctaagtaaaaaggctcaaatc
cttatcatgacttatgcaaatattatttttcgctatgggatagagggttttctcaagcag
gccaaacgctctggagccaaggcattgatcatccctgatttgcctctgcaccaggatgaa
ggtctccgcgcccatgccaagaaaatgggtatttttgtcatagaactcattacccctaat
atgagtgatgcgcgcatgaaagaaattactcagcagagcaactgcccctacctctatgct
gtggctaggcttgggatcacgggctcaaaaaccaccatcgatgatgcgctagagcgctac
attgctcgcattcgcaaaaactccaaccaaaaaatcgcactgggatttgggatacagact
catgagcaaattgaacaaatcaaagactctgtagacatcattgttgcagggagttatttc
gtgcgccaaatcaagcaaaatcccacaaaacaagccctctatctgcataccaaaaaactc
ctagagggatga

DBGET integrated database retrieval system