KEGG   Helicobacter mustelae: HMU09820Help
Entry
HMU09820          CDS       T01191                                 

Gene name
surE
Definition
(GenBank) SurE protein homolog
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
hms  Helicobacter mustelae
Pathway
hms00230  Purine metabolism
hms00240  Pyrimidine metabolism
hms00760  Nicotinate and nicotinamide metabolism
hms01100  Metabolic pathways
hms01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hms00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    HMU09820 (surE)
   00240 Pyrimidine metabolism
    HMU09820 (surE)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    HMU09820 (surE)
Enzymes [BR:hms01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     HMU09820 (surE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: CBG40239
UniProt: D3UIB6
Position
complement(1114317..1115099)
Genome map
AA seq 260 aa AA seqDB search
MRKILITNDDGFESRGLLALRDALSDLAQILVVAPAREKSACGHGLCLTSPLKFIKVDDD
FYKLDDGGPTDCVYLALNAIYEDGQKPDLIVSGINLGSNMGEDTTYSGTVAGAIEGAIQG
IPSLAISQLMKDKNLSDEYDFALAKKVIREIVQKIFSHSYPLGDRRLININVPQLEIEKC
KGYKITQKGYRLYGNNAHLNRDPRGNEYYWLGLQPLAWKDRDGILSDFTATKEGYVSITP
ITLNLTSYEDLNSLQTWMEI
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattttgattaccaatgatgatggatttgaatcgcgtggattgttggcactt
agagatgcgctcagtgatttggctcagattttggttgtagctccagcgagggaaaaatct
gcctgtggccatgggctctgcctcacttctcctttgaaatttatcaaggtggatgatgat
ttttataaattagatgatgggggccccacagattgtgtttatcttgcgctcaatgcgatt
tatgaagatggacaaaaacccgatctcatcgtctctggcatcaatttaggttcaaatatg
ggagaggatactacttattctggtacggtggctggagccatagagggggccatccaaggg
atcccatccctggctatctctcagctcatgaaggataaaaatctctcagatgaatatgat
tttgccctggcaaaaaaggtaatccgcgagattgtacaaaagatttttagtcattcttat
ccactaggagatcgcaggcttatcaatatcaatgtccctcagcttgaaattgaaaaatgc
aagggatataaaatcacgcaaaagggttatcggctctatggtaataatgcccatctcaat
cgcgacccccgtggcaatgaatattattggctaggactccagcctcttgcatggaaggat
cgcgatggcatactctctgattttaccgcgacaaaagagggatatgtctccatcaccccc
atcaccctcaatctcacaagctatgaagatctaaacagcctgcagacatggatggaaatt
tga

DBGET integrated database retrieval system