KEGG   Helicobacter mustelae: HMU10140Help
Entry
HMU10140          CDS       T01191                                 

Gene name
hemD
Definition
(GenBank) putative Uroporphyrinogen-III synthase, HemD
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hms  Helicobacter mustelae
Pathway
hms00860  Porphyrin and chlorophyll metabolism
hms01100  Metabolic pathways
hms01110  Biosynthesis of secondary metabolites
hms01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hms00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HMU10140 (hemD)
Enzymes [BR:hms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HMU10140 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 DUF1623 PAD_porph
Motif
Other DBs
NCBI-ProteinID: CBG40271
UniProt: D3UIE8
Position
complement(1149623..1150300)
Genome map
AA seq 225 aa AA seqDB search
MRKIVLVSSKPHADVETLVVNEIEHLDMLDSLRELRGDFDALVLTSKNAAQSLQQNIKKY
PQFEYLKKIPAYAIGESSAQTLGEHGFCVEYVGKDSHGSGFADEIIPMLRGKKVLYFRAK
KIVSKLDERLQAARIILKQIVAYENKRNNTHILPKPKPKSILIFTAPSHYLSFVQNFSWD
GSYIAIAIGLTTFSVFDEEIEAFVSPRQDIQSCIHFAKEIALRLP
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagattgtattagtaagctccaaaccccatgcggatgtagaaacattggtagtc
aatgagattgagcatctagatatgctggattctctaagagagcttaggggggattttgat
gcactggtgcttacctccaaaaatgcagctcaatctctgcagcaaaatataaagaaatat
ccacaatttgagtatctcaaaaaaattcccgcatatgcaattggagagtcaagcgcgcaa
acactaggcgagcatgggttttgtgtggaatatgtggggaaggattctcatggctctggt
tttgcagatgagattatccctatgctaaggggcaaaaaagtgctgtattttcgtgccaaa
aaaattgtttccaagcttgatgaaaggctgcaggctgctaggattatattgaagcagatt
gttgcatatgaaaataagcgcaataacacacacatactgccaaagcccaagccaaaaagc
atcttaattttcactgcgcccagtcattatctctcctttgtgcaaaatttttcttgggat
ggaagctatattgccattgccattggacttactacttttagtgtatttgatgaggaaatt
gaagcatttgtaagccctaggcaagacattcaaagctgcattcattttgccaaagagatt
gccctgcgcctaccttga

DBGET integrated database retrieval system