KEGG   Helicobacter mustelae: HMU10780Help
Entry
HMU10780          CDS       T01191                                 

Gene name
atoB2
Definition
(GenBank) acetyl-CoA acetyltransferase 2
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hms  Helicobacter mustelae
Pathway
hms00071  Fatty acid degradation
hms00072  Synthesis and degradation of ketone bodies
hms00280  Valine, leucine and isoleucine degradation
hms00310  Lysine degradation
hms00362  Benzoate degradation
hms00380  Tryptophan metabolism
hms00620  Pyruvate metabolism
hms00630  Glyoxylate and dicarboxylate metabolism
hms00640  Propanoate metabolism
hms00650  Butanoate metabolism
hms00900  Terpenoid backbone biosynthesis
hms01100  Metabolic pathways
hms01110  Biosynthesis of secondary metabolites
hms01120  Microbial metabolism in diverse environments
hms01130  Biosynthesis of antibiotics
hms01200  Carbon metabolism
hms01212  Fatty acid metabolism
hms02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HMU10780 (atoB2)
   00630 Glyoxylate and dicarboxylate metabolism
    HMU10780 (atoB2)
   00640 Propanoate metabolism
    HMU10780 (atoB2)
   00650 Butanoate metabolism
    HMU10780 (atoB2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HMU10780 (atoB2)
   00072 Synthesis and degradation of ketone bodies
    HMU10780 (atoB2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HMU10780 (atoB2)
   00310 Lysine degradation
    HMU10780 (atoB2)
   00380 Tryptophan metabolism
    HMU10780 (atoB2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HMU10780 (atoB2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HMU10780 (atoB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HMU10780 (atoB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hms04147]
    HMU10780 (atoB2)
Enzymes [BR:hms01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HMU10780 (atoB2)
Exosome [BR:hms04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMU10780 (atoB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CBG40334
UniProt: D3UIL0
Position
1198854..1200113
Genome map
AA seq 419 aa AA seqDB search
MRLSSEAFCKILQLCLYNVTNINKGISMEEVVIVAAKRSAIGSFLGSLKNLKATDLAKQL
AKAILQSIKLDPHLIDEVILGQVLQSNQGQNPARQVLLEIGGLEKSAFMVNKVCGSGLKA
VWLGYQAIALGDREVVLAGGVENMSLAPFLLENARSGYKLGNQTLIDAIIKDGLWCANTD
VHMGITAENLAKKYNISRTEQDEFALSSQQKATKAIQEGRFQEEIAPISIQEKKGEFIFL
QDEFVKQDSTIEALAKLKPAFLKEGSVSAGNASGINDGAAMLVLMSKTKAKELNLEILAS
LKAFASAGVEPSIMGIGAAVAAKKVMEKTGLQIKDFDLIEANEAFAAQSIACLKELGAKE
EKVNVNGGAIALGHPIGASGARILVTLIHALRNQKKNLGLATLCIGGGQGISAVIEINE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
ttgagactttcttctgaagcgttttgtaaaattttacaattatgcctctataatgtcaca
aatatcaacaaaggaatctctatggaagaagttgtgattgttgcggccaaaaggagcgcg
attggttcttttctaggtagtctaaaaaatcttaaagccacggatttagcaaagcagctc
gccaaagctatattgcaatccataaaactcgatccccatctcattgatgaggtgattttg
gggcaggttttacagagcaatcaaggacaaaatcccgcaagacaggtattgcttgaaata
ggaggactggaaaaatctgcttttatggtaaataaagtatgtggctctggcttgaaggcg
gtttggctgggctatcaagccatagccctaggggatagagaggtggtcttggcagggggt
gtagaaaacatgtcccttgctccctttctgcttgaaaatgcacgcagcggctataaattg
ggaaatcaaaccctcattgatgccatcattaaagatgggctatggtgtgccaatacagat
gtgcacatgggaatcacagcagaaaatctcgccaaaaaatacaatatctctcgaacagaa
caagatgaatttgcactatcctcacaacaaaaagccacaaaagccatccaggaggggaga
tttcaagaagagatcgctcctataagcatccaagaaaaaaaaggagaatttatcttcttg
caagatgaatttgtcaaacaagactccaccatcgaagcacttgcaaaattaaaacccgca
tttctcaaagaaggaagtgttagcgctgggaatgcttctggcatcaatgatggtgctgca
atgcttgttttgatgagcaagacaaaagccaaggagttgaatttagagattttagcaagt
ttgaaagcttttgcaagcgcgggagtggagccctctatcatggggattggtgcggctgtg
gcagcaaaaaaagtcatggaaaaaaccggattgcaaataaaagattttgatctcattgag
gcaaatgaggcatttgcagcgcaaagcattgcatgcctcaaagaacttggcgccaaagaa
gaaaaggtaaatgtcaatggtggtgcgatagcccttggacatcccattggcgcgagtgga
gcgaggatcctcgtgactctaatccatgccctgagaaatcaaaaaaagaatctagggctt
gccactctgtgtatcggtggcggacaaggcatcagtgctgtgattgaaatcaacgaataa

DBGET integrated database retrieval system