KEGG   Helicobacter mustelae: HMU10800Help
Entry
HMU10800          CDS       T01191                                 

Gene name
lpsJ
Definition
(GenBank) succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
hms  Helicobacter mustelae
Pathway
hms00072  Synthesis and degradation of ketone bodies
hms00280  Valine, leucine and isoleucine degradation
hms00650  Butanoate metabolism
hms01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    HMU10800 (lpsJ)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    HMU10800 (lpsJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HMU10800 (lpsJ)
Enzymes [BR:hms01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     HMU10800 (lpsJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C DeoRC
Motif
Other DBs
NCBI-ProteinID: CBG40336
UniProt: D3UIL2
Position
1200815..1201456
Genome map
AA seq 213 aa AA seqDB search
MALSAKELIVKRAAKEVKDGMYINLGIGIPTLIADEIERLNLDVFLQSENGLLGLGAYPR
ENEVDPDLINAGKETTTCIAGGSFFDSAESFAMIRGGHIDLAILGGMEVSQNGDLANYMI
PGKLVKGMGGAMDLVNGAKKIVVVMEHVNKKGESKVKSQCDLPLTGAKVVNRLITELGVF
DFINGKMHLIELQPNVTLEEIKQKTQAHFEVRL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcattgagcgcgaaagaattaatcgtaaaaagagcggcaaaagaagtaaaagatggc
atgtatatcaatctgggtattggcatcccgacactgattgcagatgagatagagagactc
aaccttgatgtatttttgcaatctgaaaatggacttcttggacttggagcttacccaagg
gaaaatgaagtagatcctgatttaattaatgcaggcaaggaaacgactacatgcatcgct
ggaggatcattttttgatagcgcagagtcctttgcaatgattcgcggtgggcatattgat
cttgccatccttggtggtatggaagtttcccaaaatggagatttggcaaactacatgatc
ccagggaaattggtaaaaggcatgggaggtgctatggatcttgtcaatggcgcaaaaaag
attgtcgttgttatggagcatgtaaacaaaaaaggagagagtaaagtaaaatcccaatgc
gacctgcctcttactggagcaaaagtagtcaatcgtctcatcacagagcttggtgtattt
gacttcatcaatggcaagatgcacctcatagaactccaacccaatgtaaccctagaggaa
atcaagcaaaaaacacaagcccattttgaagtacgactctaa

DBGET integrated database retrieval system