KEGG   Helicobacter mustelae: HMU13360Help
Entry
HMU13360          CDS       T01191                                 

Gene name
tpiA
Definition
(GenBank) putative triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hms  Helicobacter mustelae
Pathway
hms00010  Glycolysis / Gluconeogenesis
hms00051  Fructose and mannose metabolism
hms01100  Metabolic pathways
hms01110  Biosynthesis of secondary metabolites
hms01120  Microbial metabolism in diverse environments
hms01130  Biosynthesis of antibiotics
hms01200  Carbon metabolism
hms01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMU13360 (tpiA)
   00051 Fructose and mannose metabolism
    HMU13360 (tpiA)
   00562 Inositol phosphate metabolism
    HMU13360 (tpiA)
Enzymes [BR:hms01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HMU13360 (tpiA)
Exosome [BR:hms04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HMU13360 (tpiA)
  Exosomal proteins of bladder cancer cells
   HMU13360 (tpiA)
  Exosomal proteins of melanoma cells
   HMU13360 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBG40590
UniProt: D3UJB5
Position
1451148..1451855
Genome map
AA seq 235 aa AA seqDB search
MGKIIAGNFKSNLTKSKIAEYYKKLNASLDAKDSVYVFAPFFGLEGVEEQRFFIGAQNAY
PAKNGAFTGEITLEALQDLKIHHLLIGHSERRNILQESQEFCAQKFEFFRAQGFHIFYCI
GESLEVRQAGEDAIRHFLKSQFEGIDVNYEGLTIAYEPIWAIGTGVSADARQIQSTHEFI
KKLCPRPLLYGGSVRAENITQILQIPNVDGVLIGGASLDVGIFLEMIKSARNIKG
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagattattgctgggaattttaaaagcaatttgacaaaaagcaaaattgcagag
tattacaagaagctcaatgccagcctagatgcaaaagattctgtgtatgtctttgcacca
tttttcggattagaaggagtggaggagcagaggttttttatcggggcacagaatgcctat
cctgcaaaaaatggggcatttactggtgaaatcaccctagaagccctgcaagatctaaaa
atccatcaccttctcatcggacatagcgaacgcaggaacatcctccaagaaagccaggag
ttttgcgcacaaaaatttgaattttttagggcacagggttttcatattttttattgcatc
ggagaaagcttagaggtgcgccaagcaggtgaggatgctattagacactttctaaaaagc
caatttgagggaattgatgtcaattatgaagggctcaccattgcttatgagcccatctgg
gccattggcacaggcgtaagcgctgatgctaggcaaatacagagcactcatgaatttatc
aaaaaactctgcccacgccccctgctctatggtggaagcgtgcgggctgaaaacatcact
caaatcctgcaaatcccaaatgtcgatggggtgctcattggcggagcttcgctggatgtg
ggcattttcttggaaatgataaaatcggctcgaaatatcaaaggatga

DBGET integrated database retrieval system