KEGG   Helicobacter mustelae: HMU13960Help
Entry
HMU13960          CDS       T01191                                 

Definition
(GenBank) putative phospho-sugar mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hms  Helicobacter mustelae
Pathway
hms00010  Glycolysis / Gluconeogenesis
hms00030  Pentose phosphate pathway
hms00051  Fructose and mannose metabolism
hms00052  Galactose metabolism
hms00230  Purine metabolism
hms00500  Starch and sucrose metabolism
hms00520  Amino sugar and nucleotide sugar metabolism
hms00521  Streptomycin biosynthesis
hms01100  Metabolic pathways
hms01110  Biosynthesis of secondary metabolites
hms01120  Microbial metabolism in diverse environments
hms01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMU13960
   00030 Pentose phosphate pathway
    HMU13960
   00051 Fructose and mannose metabolism
    HMU13960
   00052 Galactose metabolism
    HMU13960
   00500 Starch and sucrose metabolism
    HMU13960
   00520 Amino sugar and nucleotide sugar metabolism
    HMU13960
  Nucleotide metabolism
   00230 Purine metabolism
    HMU13960
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HMU13960
Enzymes [BR:hms01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HMU13960
    5.4.2.8  phosphomannomutase
     HMU13960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: CBG40649
UniProt: D3UJH3
Position
complement(1524069..1525442)
Genome map
AA seq 457 aa AA seqDB search
MSIFREYDIRGIFGKDLTRNHVFAIGVFVGQRILSQGQRIVFVGFDARVHSQELLEWLGA
GLEHGGVDVVEIGMVPTPVAYFCTYHEIDGICATSSIMITGSHNPPEYNGFKITIDRKPF
YGSQIQSLRQEIESSNLVAIPRSRDRVCVDALSQYVAFLSTHFQSLENFPYAIALDYGNG
VAGLGMERILENLGIHHQSLYANPDGTFPNHHPDPSEEKNLKDLKDLMRTQDLPIGLAFD
GDGDRIALLTQNHHFKGDELGILFAKQIAQNKPNPLIIGEVKCSQVMYDAINAFGKGLMY
KTGHSNLKVKLKELGADLAVEMSGHIFFHDRYYGYDDATYAGLRALELFAKKSPKELEDV
IAQLPKVYATPEEKIPTTEEEKFEKIASLHQRLKNPPLGFPKIVEIIAIDGVRVVFEKGW
GLVRASNTTPVLVTRFEAENEALAMEYKKALLKLLES
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttttcgagaatatgacattcggggcatctttggaaaagatttgacaaggaat
cacgtttttgccattggggtttttgtggggcagagaatcctctcccagggacaaagaatt
gtttttgtaggttttgatgcgcgcgtgcatagccaggaacttttggagtggctgggtgca
gggcttgagcatggcggggtggatgtagtagagattggcatggtccccacacctgtggca
tatttttgcacctatcatgagattgatgggatttgtgctacaagctccattatgattaca
ggctctcacaacccaccagagtacaatggcttcaagattaccattgatcgtaagcccttt
tatggaagccaaatccaaagcctgcgccaagagatagaatcaagcaatcttgttgccatt
cctaggagtagggatagggtttgtgtggatgcgctgagccaatatgtggcatttttgagc
acgcattttcaaagtcttgaaaatttcccctatgcaatcgcgctagattatggcaatggc
gtagcgggcttgggaatggagaggattttggaaaatctaggcatccatcatcaaagcctc
tatgccaatcctgatggaacttttcccaatcatcatcctgaccccagtgaagaaaaaaac
ctaaaagatctcaaggatttgatgcgcactcaggatttgcccattggtcttgcctttgat
ggggatggggataggattgcgctactgacgcaaaatcatcatttcaagggcgatgaattg
ggcattttgtttgccaaacaaatcgcacaaaataagccaaatcccctcattatcggcgag
gtgaaatgctctcaagtgatgtatgatgccatcaatgcatttggcaagggtctcatgtac
aaaactggccatagcaatctaaaggtcaagctcaaggaattgggcgcggatttggccgtg
gagatgagcgggcatattttctttcatgatcgttattatggctatgatgatgccacttat
gcggggctaagggcactagagctatttgccaaaaagtctcccaaagagctggaggatgtt
attgcgcaattacccaaggtctatgccactccagaggaaaaaattcccaccacagaggag
gagaaatttgaaaaaatcgcctccttgcaccaaaggctaaaaaatccacccctaggattt
cctaaaatcgtagagattattgctattgatggggtgcgggtggtctttgaaaagggttgg
ggattggtgcgagcgagcaatactacacccgtgcttgtcacaagatttgaagccgaaaat
gaagccctggcgatggaatacaaaaaggcattgctcaagctcttggaatcttag

DBGET integrated database retrieval system