KEGG   Halomicrobium mukohataei: Hmuk_0719
Entry
Hmuk_0719         CDS       T00982                                 

Definition
(GenBank) 50S ribosomal protein L40e
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
hmu  Halomicrobium mukohataei
Pathway
hmu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Hmuk_0719
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hmu03011]
    Hmuk_0719
   04121 Ubiquitin system [BR:hmu04121]
    Hmuk_0719
Ribosome [BR:hmu03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    Hmuk_0719
  Archaea
    Hmuk_0719
Ubiquitin system [BR:hmu04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   Hmuk_0719
SSDB
Motif
Pfam: Ribosomal_L40e DZR zinc_ribbon_2 Ribosomal_L37e DHHC zf-ribbon_3
Other DBs
NCBI-ProteinID: ACV46850
UniProt: C7NZU2
Position
complement(687771..687920)
AA seq 49 aa
MAKFEEASERLLNKQICMRCNARNPARTEKCRKCGYKKLRPKASEPRSA
NT seq 150 nt   +upstreamnt  +downstreamnt
atggctaagttcgaagaagcgtccgagcgactcctcaacaagcagatctgcatgcggtgt
aacgctcgcaacccagcccgcacagagaagtgccgcaagtgtggctacaagaagctccga
ccgaaggccagcgaaccccgctcggcctga

DBGET integrated database retrieval system