KEGG   Halothiobacillus neapolitanus: Hneap_0775Help
Entry
Hneap_0775        CDS       T01104                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
hna  Halothiobacillus neapolitanus
Pathway
hna00500  Starch and sucrose metabolism
hna01100  Metabolic pathways
hna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Hneap_0775
Enzymes [BR:hna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Hneap_0775
Exosome [BR:hna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Hneap_0775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ACX95624
UniProt: D0KYV1
Position
complement(833167..835332)
Genome map
AA seq 721 aa AA seqDB search
MQLDFQPIIESRMHDPFSLLGRHPLGEGKCRFHTYQPQAEHIRILSTHGEWLELTADADF
PGVFAGLFTEDLLPLHPVLEIETAEHHKYQITDPYSFGPVLGELDLYLFGEGKHYDLWKV
LGAHVITIDGVEGVTFAVWAPNASRVSVVGDFNNWDGRRHPMRNRISSGVWELFIPGLSA
GDFYKFEIKNRDTQATSVRTDPFGRSFELRPNTAAKVVSDEEFQWTDQFWLKAREQNDWM
HAPMNVYEVHLGSWKLTGKQFPTYAELAEQLIPYVKERGYTHIELLPITEHPFDGSWGYQ
TTGYFAPTSRFGTPEQFKQFVNKAHEAGIGIILDWVPAHFPRDEFALARFDGTALYEHED
PRRGEHRDWGTLIFNYGRKEVSNFLIASALYWLEEMHLDGLRVDAVASMLYLDYSREHGD
WLPNAYGGRENLEAIDFLRALNHVTQSRNPGALMMAEESTAWPLVSRPPEVGGLGFALKW
NMGWMNDTLKYFQEDPINRQYHHNNLTFGLLYTFTENFVLPFSHDEVVHGKGSLLNKMPG
DEWQKFANLRLLLAYQCAYPGKKLLFMGCEFGQGNEWNHAKQLDWWMLEYKLHQGISQLS
TALNHLYKNEVALHYHDFEGCGFSWNDCNDRQNSVISFFRHAKGQSILTILNFTPVVRQN
YKIGIPNTDRLNIVFNSDESVYGGSATALELTHHKNSPYNGQSGHIELTLPPLGALMIRI
N
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgcagttagattttcaacccattatcgaatcgagaatgcatgatccgttttccttgcta
ggccgccatccacttggcgagggcaaatgccgctttcacacctaccagccgcaggccgaa
cacatcaggatattgagcactcatggcgagtggcttgaattgacagccgatgccgacttc
cccggtgtatttgctgggctcttcaccgaggacttgctgcctcttcacccggttctggaa
atcgaaactgctgaacaccacaagtaccagatcacggatccctacagcttcgggccagta
ctcggcgaactcgacttgtacttattcggcgaaggcaagcactacgacctgtggaaagtg
ctgggcgcacatgtcatcaccattgacggcgtggagggcgtaacattcgccgtatgggct
cccaatgccagccgcgtcagcgtcgtgggcgatttcaacaactgggatggccgccgccat
ccgatgcgcaatcgcatcagtagtggcgtttgggagttgtttatcccgggcctttctgcc
ggcgatttttataagtttgaaatcaaaaacagagatactcaggccaccagcgttcgcact
gatccctttggccgcagctttgaacttcgccccaatacggccgccaaggtagtcagtgac
gaagaattccagtggacggatcaattctggctcaaggcgcgcgagcaaaacgactggatg
cacgccccgatgaatgtctatgaagttcacttaggttcttggaaactgacgggcaaacaa
ttcccaacctacgcggaattggcggagcaactgattccgtatgttaaagagcgcggttac
actcacattgaattgctgcccatcacggagcaccccttcgatggctcatggggttatcaa
accacaggctatttcgcgccgacctcccgtttcggcacgccggaacaattcaagcagttc
gtcaacaaggcacacgaagcaggcataggcattattcttgactgggttccggctcacttt
ccccgcgatgagtttgccctcgcccgcttcgatggcacggcactttatgagcacgaggac
ccaaggcgcggggaacaccgtgactggggtaccctgatcttcaattacgggcgcaaggag
gtcagcaattttttgattgcttccgccctgtactggctcgaagaaatgcatctcgatggc
ctgcgtgtcgatgctgtggcatccatgctgtatctcgattattcacgcgaacatggcgat
tggctgccgaacgcctacggcgggcgcgaaaacttggaggccattgattttcttcgtgca
ctgaaccatgtgacacaaagccggaaccccggcgccttgatgatggcggaagaatccacc
gcctggccattggtgtccaggccgcccgaggtcggcgggcttggattcgcattgaaatgg
aacatgggctggatgaatgacacgctgaaatactttcaggaagaccccatcaaccggcaa
tatcaccacaacaatcttacattcggcctgctctacaccttcacggagaacttcgtcctt
cccttttcgcacgatgaagtcgtgcatggtaaaggctcgttgctgaacaaaatgcccggt
gacgaatggcagaaattcgccaatcttcgccttcttctggcctaccaatgcgcctatcca
ggaaagaaactcctgttcatgggctgcgaattcggccagggcaacgagtggaatcatgcc
aagcaactcgactggtggatgcttgaatacaaactccatcaaggcatcagtcaactcagc
acggcactcaatcacctctataaaaatgaagtggcactgcattaccatgattttgaagga
tgcgggttttcatggaacgactgtaacgaccgccagaactcagtcatcagttttttcagg
cacgccaaaggccagagcatcctgaccatacttaatttcacgcccgtcgtcagacagaac
tacaaaatcggcataccgaataccgaccggttgaatatagtattcaattccgacgagtct
gtttatggcggctcagccaccgcattggaattaactcaccacaaaaacagtccttataat
ggtcaaagtggccatatagaactgacactaccgccacttggcgccctgatgatcagaata
aattga

DBGET integrated database retrieval system