KEGG   Halothiobacillus neapolitanus: Hneap_1053Help
Entry
Hneap_1053        CDS       T01104                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hna  Halothiobacillus neapolitanus
Pathway
hna00450  Selenocompound metabolism
hna00970  Aminoacyl-tRNA biosynthesis
hna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Hneap_1053
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Hneap_1053
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hna01007]
    Hneap_1053
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hna03016]
    Hneap_1053
Enzymes [BR:hna01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Hneap_1053
Amino acid related enzymes [BR:hna01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Hneap_1053
Transfer RNA biogenesis [BR:hna03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Hneap_1053
 Prokaryotic type
   Other AARSs
    Hneap_1053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ACX95889
UniProt: D0KZL6
Position
complement(1137060..1139117)
Genome map
AA seq 685 aa AA seqDB search
MTLQAPRRILVTSALPYANGPLHLGHIIETIQTDIWVRAQKLFGNECRYLCADDTHGTPI
MLKAQQEGITPEELITRIGNSHKADFADFMIGFDIFHSTHSEENRRMASEIFKRLDARGL
ISRKTIKQAYDPEKEMFLPDRFIKGECPKCGALDQYGDNCEKCGATYSPTELKNPRSVLS
GATPVERDSEHYFFDLPKMQDRLKQWLSEDRVQPAIRAKLQEWFDSGLQAWDISRDAPYF
GFEIPGAPGKFFYVWLDAPIGYIGAFLKLAESTGLDFDEYWGENAQTELIHFIGKDIAYF
HTLFWPATLMGAGLRTPTAVYAHGFLTLNGEKMSKSRGTFIQARTYLNHLDPQALRYYFA
AKLSSGIDDIDLSLEDFRLRVNSDLVGKVVNIASRCAGFIHKQFNSELSAELAHSELHEQ
LVAAAESIKTRYERRETGQAMREIMALADLVNQYIDEKKPWAMAKSPDSLAAVQGVCTDG
LNAFRILMTYLTPVLPAMSAKAAQFLNLAEFRWSDLARPMVGHKINAFEPLMTRIEQTAI
DALIKATQEEAQAMNQANTTPLTEVKAPRAEIEPIAEEITIDQFTAVDLRVARIVNAEHV
EGAAKLLRLTLDIDEEKTRQVFAGIKSAYDPATLVGRHTVMVANLKPRQMKFGLSEGMVL
AAGDGKGGLFILSPDEGATAGMRVK
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgacacttcaagcccctcgtcgcatcttggtgacatctgctctgccctatgccaatggc
ccacttcacttggggcatatcatcgaaaccatccagacggatatttgggtgcgcgcacaa
aaactgtttggcaatgaatgccgctatctgtgtgcggacgatacgcatggcacgcccatt
atgctcaaggcgcagcaagagggaatcacgccggaagagctcattacgcgcataggcaat
agtcacaaagccgattttgctgatttcatgattggcttcgacatatttcacagtacgcat
tccgaagaaaaccggcgtatggccagtgaaattttcaagcggcttgacgcacgtggcttg
atcagtcgcaaaaccatcaagcaagcctatgatccggaaaaggaaatgttcctgcccgat
cgcttcatcaagggtgagtgccccaagtgcggcgccttggaccaatacggtgacaactgc
gagaaatgtggcgctacctacagcccgaccgaactaaagaatccgcgctcagtgctttcc
ggtgcaacacccgtcgaacgcgattccgaacactatttcttcgaccttccaaaaatgcaa
gatcggctcaaacaatggttgagcgaagaccgtgtacagcccgccattcgcgcaaaactg
caggaatggtttgatagcggcctgcaggcctgggatatttcacgggatgcgccctatttc
ggctttgagatacccggcgcacccggcaaattcttttatgtctggctggatgcgcccatc
ggctatatcggcgcctttctgaaactggccgaatcgacagggcttgatttcgacgaatat
tggggcgaaaacgcccaaaccgaactcatccattttatcggcaaggatatcgcgtacttc
cacacgctgttctggccagccacgctcatgggcgctgggttgcgcacaccgacagccgtg
tatgctcatggctttttgaccctcaacggcgaaaaaatgagcaagtcgcgcggcacattc
atccaggcccgcacctatctcaaccacctcgacccgcaggccctgcgctactattttgcg
gccaagctcagcagcggtatcgacgacatcgatctctcgctcgaagatttccggctgcgc
gtcaactcggatctggtaggcaaggtcgtcaatattgccagccgttgcgccggttttatt
cacaagcagttcaatagtgagttgagtgccgaacttgcccacagcgaactccacgaacaa
ctcgtggccgccgccgaatccatcaagacacgctatgagcgccgtgaaaccggtcaagcc
atgcgcgaaatcatggcgctggctgacttggtgaatcaatacatcgatgagaaaaaaccc
tgggccatggccaagtcgcccgactcgcttgccgccgttcaaggtgtgtgtaccgatggc
ctgaatgcctttcgcatcttgatgacctacctcacgcccgttctgccggccatgagtgcc
aaggcggcacaattcctgaacctggctgaattccgttggtcggatcttgcacgtccgatg
gttggacacaagatcaacgcctttgaaccgctgatgacacgtatcgaacagacagccatc
gatgcgctgatcaaagcgacgcaagaagaagctcaagcaatgaaccaagcgaacaccacg
ccgctcacagaagtgaaagcaccgcgtgccgaaattgaaccgattgcggaagaaatcacc
atcgaccaattcacggccgtggatttgcgcgtggcgcgaatcgtcaatgccgagcacgtc
gaaggtgcagcgaaattgttacgattgacgctggatatcgatgaggagaaaacccgccag
gtgttcgccggaatcaaatccgcttatgatcctgccaccctcgttggccgccataccgtc
atggtcgccaacctgaaaccccgccagatgaaattcggcctgtcggaaggcatggtactg
gccgcgggcgatggcaaaggcgggctattcattttgtcacccgacgaaggcgcgaccgca
ggcatgcgtgtgaaatag

DBGET integrated database retrieval system