KEGG   Halothiobacillus neapolitanus: Hneap_1241Help
Entry
Hneap_1241        CDS       T01104                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hna  Halothiobacillus neapolitanus
Pathway
hna00010  Glycolysis / Gluconeogenesis
hna00052  Galactose metabolism
hna00500  Starch and sucrose metabolism
hna00520  Amino sugar and nucleotide sugar metabolism
hna00521  Streptomycin biosynthesis
hna01100  Metabolic pathways
hna01110  Biosynthesis of secondary metabolites
hna01120  Microbial metabolism in diverse environments
hna01130  Biosynthesis of antibiotics
hna01200  Carbon metabolism
Module
hna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hneap_1241
   00052 Galactose metabolism
    Hneap_1241
   00500 Starch and sucrose metabolism
    Hneap_1241
   00520 Amino sugar and nucleotide sugar metabolism
    Hneap_1241
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hneap_1241
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Hneap_1241
Enzymes [BR:hna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Hneap_1241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ACX96077
UniProt: D0L054
Position
complement(1344700..1345716)
Genome map
AA seq 338 aa AA seqDB search
MILAGDIGGTKTLLALFEEESGHILFQKRFESASADRFDTLLADFLAEVERSALVKGAIT
AAGFGIAGPVTGEPGSQKVQATNLPWHMDSRTISQQLGGVPVVFANDLVASGTAAIASKP
AHRVALNPFAMESTGHAAVIAAGTGLGEALFYYDGVTHHPMPTEGGHTDFAPNNALESEL
WAYLRRHHNGHVSYERILCGRGFYHLYGFVRDQELAPESPHMLEKFAQVSDPSALITQQA
VAGSDAISVRACQLFARIYGAEAGNLALKSLPFGGVFVAGAIAGHILPFLQQEFMRGFLD
KGRFSELLKQIPVWVVSDSELALKGAAVLAINLRGRNN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgattttagctggcgatatcggcggcacgaagacgttattggcattgtttgaggaagag
agtgggcacattcttttccagaaacgcttcgagagtgcatcagccgatcgattcgacaca
ttgcttgctgattttctggccgaagtcgagcgttctgcgctggtcaagggggcaattacg
gccgcgggcttcggtatcgcaggcccggtaacgggcgagccgggcagccagaaagtacag
gccaccaatctgccctggcacatggacagtcgaacgatttcacaacaactcggtggcgtt
ccggtcgtgttcgccaatgatctggtcgcgagcggcacggcggccattgccagcaaaccc
gcgcaccgtgttgcgctcaatccattcgcgatggaatcgacgggacatgccgccgttatt
gccgctggcaccggcctcggcgaggcattgttttattatgatggcgttacacaccatccc
atgcctaccgaaggcggtcacactgattttgcgcccaataatgcgcttgaatctgagctt
tgggcgtatttgcgccgccaccataacggacacgtgagttacgaacgtattttatgcggg
cgtggtttttatcatttatatggttttgtgcgcgatcaagaattagcgccggagtcaccg
cacatgcttgaaaaatttgcgcaggtcagtgatcccagcgcactgattacgcagcaagcg
gtcgcgggcagcgacgccatcagcgtgcgggcctgtcaactgttcgcccgtatttatggt
gccgaagcgggtaatctggcacttaaatccttgcccttcggaggcgtttttgttgccggg
gccatcgctgggcacattctgccgttcttgcagcaagaattcatgcgtggattcctggat
aaaggccgtttctccgagcttctgaaacaaatcccagtgtgggttgttagcgattctgag
cttgcgttgaaaggcgcggccgtactcgcgataaatttacgcggacgaaacaactga

DBGET integrated database retrieval system