KEGG   Halothiobacillus neapolitanus: Hneap_1279Help
Entry
Hneap_1279        CDS       T01104                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
hna  Halothiobacillus neapolitanus
Brite
KEGG Orthology (KO) [BR:hna00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Hneap_1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ACX96115
UniProt: D0L092
Position
1384868..1385296
Genome map
AA seq 142 aa AA seqDB search
MIFMDQISDHPRENDANDASIEIQVKTTFVPEHSDSKLNRFAFGYEIHIANRGLHTVQLM
DRHWQIDMGNGCIQEVRGEGVVGEQPVLAPGESYQYQSGAIIETPAGRMWGDYGFVTENG
ERFRAPIPLFHLLAPDQFRPIH
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgatattcatggaccaaatctcagatcatccgcgagaaaacgatgccaatgatgcatcc
atcgaaattcaagttaaaacgacattcgtaccggagcattccgactccaaattgaatcgc
tttgccttcgggtacgaaattcacatcgcaaaccggggattacataccgtccagctcatg
gatcgacactggcagatcgacatgggcaacggctgcatccaggaagtacggggagaaggc
gtcgtcggtgagcagccggttctggcacctggcgaatcctatcaatatcaatccggggct
atcatcgaaacacccgccgggcgcatgtggggcgattacggtttcgtgactgaaaacgga
gaaagattccgggctccgatccccctgttccatcttttggcccccgatcaattccgccct
attcactga

DBGET integrated database retrieval system