KEGG   Halothiobacillus neapolitanus: Hneap_1553Help
Entry
Hneap_1553        CDS       T01104                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hna  Halothiobacillus neapolitanus
Pathway
hna00010  Glycolysis / Gluconeogenesis
hna00020  Citrate cycle (TCA cycle)
hna00620  Pyruvate metabolism
hna01100  Metabolic pathways
hna01110  Biosynthesis of secondary metabolites
hna01120  Microbial metabolism in diverse environments
hna01130  Biosynthesis of antibiotics
hna01200  Carbon metabolism
Module
hna_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hneap_1553
   00020 Citrate cycle (TCA cycle)
    Hneap_1553
   00620 Pyruvate metabolism
    Hneap_1553
Enzymes [BR:hna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Hneap_1553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: ACX96383
UniProt: D0L110
Position
1689625..1690953
Genome map
AA seq 442 aa AA seqDB search
MTVKSVPLPDIGNFKDLPVIEVLVAAGDRVEAEQSLITLESDKATMEIPAPFAGVVKKVL
VKTDDTVNVGDIIVEMDADDAASPAPEPAKTAPAAVSAPAPEPAAPAPVEAAPEVAPATM
PATAPANEENTTYPINSPTPGAVFHASPSVRAFARTLGVDLAKVSGTGIKGRIQKTDVTA
FVKNTLTQATSPAATAGGSIPPLPSIDFSQFGEIETVPLSRIQKRSGKHLSTCWLNIPHV
TQFDETDITDLEAFRQSLKARAEKAGVKLTPLVFILKAVARALADYPKFNASLDVSGENL
ILKKYIHIGVAVDTPNGLVVPVIRNVDRKGLFELSAELAEVSARARDGKLSPEDMSGGCF
SISSLGGIGGTQFTPIVNGPEVAILGVSRSKMSPVWNGETFEPRLMLPLALSYDHRVIDG
AQGARFITALSAVLSDLRELIL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaaatcagtccccttgccggatatcggcaacttcaaagacttgcctgtcatc
gaagtcctggttgccgcaggcgaccgggttgaagccgagcaatcactgatcacgctcgaa
tccgacaaggccaccatggaaatccccgcgccgttcgccggcgtggtgaaaaaggtgctg
gtcaaaacggacgacaccgtcaacgttggcgacatcattgtcgaaatggatgcagatgac
gcggcaagcccagcaccggaaccagccaagacagcaccagccgcggtaagcgcaccggcg
cctgaaccagccgcacctgctcccgtagaagctgcgcctgaggtagctccggcaacaatg
cccgcaactgctccagcgaacgaagagaatacaacctaccccatcaactcaccgacgcca
ggtgctgtgtttcacgccagcccttccgtacgcgcatttgcccgcacgctgggcgtggac
cttgccaaagtcagcgggaccgggataaaaggacgtatccagaaaaccgacgtcactgca
ttcgtcaaaaacacactgactcaagcgacaagcccggcggcaacagccggtggctcgatt
ccaccgctgcccagcatcgacttcagccagttcggcgaaatcgaaaccgtgccgttatcc
cggattcaaaagcgttcgggcaagcatttgtctacctgctggctgaatattccgcacgtc
acccagttcgatgaaaccgacatcaccgatctcgaagctttccgccaatcgctgaaggca
cgcgcggaaaaagctggcgtcaagctcaccccgttggtattcattctcaaagcggttgcg
cgcgcactcgccgactaccccaaattcaacgcctcactcgatgtcagtggcgagaacctg
attctcaagaaatacatccacatcggcgtggctgtcgacacacccaatggcctcgtcgtc
cccgtcatccgcaacgtcgatcgaaagggcctgttcgaactttcagccgaactcgccgaa
gtgagcgcccgtgcgcgggatggcaaattgagcccggaggatatgtccggcggctgcttc
tcgatctccagcctcggtggcatcggcggcacacagttcactccaattgtgaacgggccg
gaagttgccattctcggtgtttcccgctcgaaaatgagcccggtctggaacggtgaaacc
ttcgaaccgcgcctgatgctaccgctcgccctgtcctacgatcaccgcgtgatcgatggc
gctcagggtgcccgcttcatcaccgctctctcggctgtgctgagtgatttgcgcgaactc
attctctaa

DBGET integrated database retrieval system