KEGG   Halothiobacillus neapolitanus: Hneap_1609
Entry
Hneap_1609        CDS       T01104                                 
Name
(GenBank) Lytic transglycosylase catalytic
  KO
K03194  type IV secretion system protein VirB1
Organism
hna  Halothiobacillus neapolitanus
Pathway
hna03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hna00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Hneap_1609
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hna02044]
    Hneap_1609
Secretion system [BR:hna02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Hneap_1609
SSDB
Motif
Pfam: SLT TraH_2
Other DBs
NCBI-ProteinID: ACX96437
UniProt: D0L164
Position
complement(1748600..1749133)
AA seq 177 aa
MDLPTLYAQCAPSVAPQTLAAIVRVESGGNPWRIGINGDYVLPQQPANQAEAIRDANRLI
GMGYSIDMGLMQVNLKNLNALKLSVEQVFDPCTNIKAGAQILQNFYQKSASDIGQGQHAL
RRAISAYNTGNFINGFTNGYVAKVTKERPVHAQSDELVSAMLAKTLVVWSPLNGNEY
NT seq 534 nt   +upstreamnt  +downstreamnt
atggacttaccaacgctgtatgctcaatgtgcgcccagtgtggcaccacaaaccctagcc
gccatcgtgcgggttgagtccggtggtaatccgtggcggatcggcatcaatggtgattat
gtattgccacaacagcctgcaaatcaggccgaggccatccgtgatgcgaaccggctgatc
gggatgggatacagcatcgacatgggcttgatgcaagtcaatttgaagaacttgaatgcg
ctgaaactgagtgtcgaacaggtgtttgatccctgcaccaacatcaaagcaggtgcacag
atattgcagaatttctaccaaaaatcagcaagcgacattggccaggggcaacacgcactt
cgccgcgctatttctgcatacaacactgggaatttcatcaatggtttcacgaacggctat
gtagccaaggtcaccaaagagcggcctgttcacgctcaatctgatgagctggtttcagcc
atgttggccaagactttggtggtttggtcaccactaaatggaaatgagtattga

DBGET integrated database retrieval system