KEGG   Halothiobacillus neapolitanus: Hneap_1966Help
Entry
Hneap_1966        CDS       T01104                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hna  Halothiobacillus neapolitanus
Pathway
hna00010  Glycolysis / Gluconeogenesis
hna00051  Fructose and mannose metabolism
hna00562  Inositol phosphate metabolism
hna00710  Carbon fixation in photosynthetic organisms
hna01100  Metabolic pathways
hna01110  Biosynthesis of secondary metabolites
hna01120  Microbial metabolism in diverse environments
hna01130  Biosynthesis of antibiotics
hna01200  Carbon metabolism
hna01230  Biosynthesis of amino acids
Module
hna_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hneap_1966
   00051 Fructose and mannose metabolism
    Hneap_1966
   00562 Inositol phosphate metabolism
    Hneap_1966
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Hneap_1966
Enzymes [BR:hna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Hneap_1966
Exosome [BR:hna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Hneap_1966
  Exosomal proteins of bladder cancer cells
   Hneap_1966
  Exosomal proteins of melanoma cells
   Hneap_1966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Mersacidin
Motif
Other DBs
NCBI-ProteinID: ACX96788
UniProt: D0KVF8
Position
complement(2101217..2101987)
Genome map
AA seq 256 aa AA seqDB search
MRKPIVLGNWKLNGSTASSEALVAGILAGVTGLDAIDVGVCPPFVLIPQTVRQAAHTDLK
VGAQDCSEYVEGAYTAEVSADMLRDVGCHHVLIGHSERRALFGEQNDVIARKVGRALAAG
LMPVLCVGETLEERQSGHMDEVVCSQVQAVINEVGVAAFDRIVIAYEPVWAIGTGLTASP
EQAQAMHATIRGLIAGQNASVARAVRIQYGGSVKPDNAAELFSQPDIDGGLIGGASLKAE
DFMIICRAAADSLGTV
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagccaatcgtactcggaaactggaagcttaatggctctacggcctcttcggag
gcgttggtggcgggcattcttgccggggtaacgggattggatgcgatcgacgtaggggtt
tgccctccgttcgttcttattccgcaaacggtgcgccaagcagcgcatacggatttgaag
gttggtgctcaggattgctcggagtatgtcgagggtgcctacacggccgaagtctcggca
gacatgctgcgtgatgtaggttgtcaccatgtgctgatcggtcactccgagcgccgggca
cttttcggtgagcagaatgacgtgattgctcgcaaagtcgggcgcgctctggcagccggt
ctcatgcccgttctgtgtgtgggcgaaactttggaagagcgtcaatccgggcatatggat
gaagtcgtctgctctcaagtgcaggcggtcattaacgaggttggtgtcgctgcatttgat
cgaatcgttatcgcgtatgagcctgtctgggcgatcgggaccggtttgactgcttcgccc
gagcaggcgcaggcaatgcacgctacgattcgtggtctgattgcagggcaaaacgcatcg
gtcgcgcgtgccgtgcgcattcagtacggtggatcggtgaagccggataacgctgccgaa
ctgttttcccagcctgacattgatggcggcttgattggcggcgcatccttgaaggccgaa
gattttatgattatttgtcgtgctgcggccgactcgcttggaaccgtgtga

DBGET integrated database retrieval system