KEGG   Halothiobacillus neapolitanus: Hneap_2117Help
Entry
Hneap_2117        CDS       T01104                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
hna  Halothiobacillus neapolitanus
Pathway
hna00790  Folate biosynthesis
hna01100  Metabolic pathways
Module
hna_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Hneap_2117
Enzymes [BR:hna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Hneap_2117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACX96934
UniProt: D0KW31
Position
2273640..2274251
Genome map
AA seq 203 aa AA seqDB search
MSPLHEDDFPEPLDQSQTRIATIEAAVHQILDALGEDPNREGLQDTPKRVAKALLYLTHG
LNKPLESAIGNALFASDNDEMVVVRNIEFYSLCEHHMLPIIGHVDIGYIPQGKVIGLSKL
ARIVDLYARRLQIQENMTQQIADAVRESTDARGVAVQVRAAHMCMAMRGVEKVNAETITS
MMLGTFRSDARARNEFLQLIGRG
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagccccctgcacgaagacgactttcccgagcccctcgaccagagccagacgcgtatc
gccaccatcgaagccgcggtgcaccagattcttgatgcgctgggtgaagacccgaaccgt
gaaggcctgcaagacacgcccaaacgcgtcgccaaggcattgctttatctgacacacggt
ctgaacaagccgctggaaagtgcgattggcaatgcgttgttcgcctcggataacgatgag
atggtcgtggttcgcaacatcgagttctacagcttatgcgagcaccatatgctgccgatc
atcggtcacgtggatattggctatattccgcagggtaaggtgatcggcctgtcgaaactg
gcgcgcatcgttgatttatatgcccgtcgcttgcagattcaggaaaacatgacccaacag
atcgccgatgccgtgcgtgaatccaccgatgcccgtggtgtggccgttcaggtgcgtgcc
gcgcatatgtgcatggcgatgcgcggggtggagaaggtgaatgccgaaacaatcacttcg
atgatgctgggcaccttccgcagcgatgcgcgggcgcgtaacgagtttttgcaattgatc
ggcaggggttag

DBGET integrated database retrieval system