KEGG   Halothiobacillus neapolitanus: Hneap_2363Help
Entry
Hneap_2363        CDS       T01104                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
hna  Halothiobacillus neapolitanus
Pathway
hna00020  Citrate cycle (TCA cycle)
hna00190  Oxidative phosphorylation
hna00650  Butanoate metabolism
hna01100  Metabolic pathways
hna01110  Biosynthesis of secondary metabolites
hna01120  Microbial metabolism in diverse environments
hna01130  Biosynthesis of antibiotics
hna01200  Carbon metabolism
Module
hna_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hna00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hneap_2363
   00650 Butanoate metabolism
    Hneap_2363
  Energy metabolism
   00190 Oxidative phosphorylation
    Hneap_2363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACX97172
UniProt: D0KX52
Position
complement(2528887..2529237)
Genome map
AA seq 116 aa AA seqDB search
MVNRVPSGARYGIKDWLVQRLTAVVMVIYTLFITGYLLWHPVSNFADWQMMFHSLPVRLF
SLIFLLSLFVHAWLGMRDIFMDYIHPTLIRLGLHALVILALVAYTAWAVQILWSPA
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaccgcgttcccagcggcgcgcgctacggcatcaaggattggctggtgcagcgg
ctcacggccgtcgttatggtcatttataccctgttcatcaccgggtatctgttgtggcat
cccgtatcgaatttcgccgactggcaaatgatgttccatagcctgcccgttcgcctgttc
agcctgatttttctattgagcttgtttgttcacgcttggttgggcatgcgggatattttc
atggattacattcatcccacgttgatccggctcggcctgcacgcactcgtgattctggcg
ctggtggcctataccgcgtgggccgtgcagattttatggagccctgcatga

DBGET integrated database retrieval system