KEGG   Hyphomonas neptunium: HNE_0564Help
Entry
HNE_0564          CDS       T00397                                 

Gene name
dnaA
Definition
(GenBank) chromosomal replication initiator protein DnaA
  KO
K02313  chromosomal replication initiator protein
Organism
hne  Hyphomonas neptunium
Pathway
hne02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hne00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HNE_0564 (dnaA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hne03032]
    HNE_0564 (dnaA)
   03036 Chromosome and associated proteins [BR:hne03036]
    HNE_0564 (dnaA)
DNA replication proteins [BR:hne03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    HNE_0564 (dnaA)
Chromosome and associated proteins [BR:hne03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    HNE_0564 (dnaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C AAA AAA_30 DnaA_N AAA_22 IstB_IS21 AAA_16 ATPase AAA_5 AAA_28 PhoH RuvB_N TrwB_AAD_bind AAA_19 AAA_11 NACHT AAA_25 AAA_24 RNA_helicase ATPase_2 DUF2075 AAA_18 AAA_21 DUF2791 Mg_chelatase AAA_14 DUF1059 AAA_33 AAA_23 Sigma54_activat Kinesin AAA_29
Motif
Other DBs
NCBI-ProteinID: ABI78206
UniProt: Q0C4Q0
Position
complement(561363..562736)
Genome map
AA seq 457 aa AA seqDB search
MIWNDVRDVLRDKITESEFTRWIADLRVVAEHNGEMIVAARDPLAFDRVSSQHLRVIEKL
WAAADPAERALKLICWRNAPADLRDLVDDPWAVAETPVPAEPQAPATSSGAGPAMTFDTL
VTGPSNEIAVTLAKRIAAGLPAGTATTLIYGPPGTGKTHLMQALRLEAARRDTARRIVYL
TAEEFMSAYLDGVKARDTSDLKKRLRAASILLIDDLHRIAGKPGTETELYQNIREVTSNG
GQVVLVGDSAPGDASGFGQRMRSEIKGATAVEVELPDAGMRREILIRLAGHIAENHPAFV
LTDEMMQRLNSGIRGPGRELTGAVWSLYTEAGFGERAPTMEMLDRIVRRHAGEQREPSID
VIKRATLKVFPIAKTDLEGPSKMRGFVYPRQIAMYLCRTMTRKSFPQIGRAFGKRDHTTV
LYAYRRMDGDIGKDQELAADIARVQTVVLELMESGQI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgatttggaacgatgtgcgcgatgtcctgcgggacaagatcacggaatctgaattcacg
cgctggatcgcagacctgcgcgttgtcgcagaacacaatggcgaaatgattgtcgccgcg
cgcgatccgctggcttttgaccgcgtcagcagccagcatctgcgcgtgatcgagaaattg
tgggcagccgctgacccggctgaacgcgccctcaaattgatctgttggcggaatgctccg
gcagacctgcgcgatctggtcgatgacccatgggctgttgccgagacgccggttccggcc
gagccgcaggcacccgccacatcgtcgggcgctggcccggcaatgaccttcgacacgctg
gtgaccggcccgtcgaacgaaatcgccgtgacgctggcaaagcgtattgccgcgggcctt
cctgccggcacggccaccacgctgatctatggcccgcccggcaccggcaagacccacctc
atgcaggccctccgtctggaagccgcccgccgggacactgcccgccggatcgtctacctg
accgccgaggaattcatgtcggcctatctggacggtgtgaaggcacgcgacacgagcgac
ctgaagaagcgtctgcgggccgcctcgatcctgctgatcgacgacctgcaccgcatcgcc
ggcaaacccggcacggaaaccgagctctatcagaacatccgcgaagtcacgtccaatggc
gggcaggttgttctggtcggcgactctgccccaggcgatgcctccggtttcggccagcgg
atgcgcagcgagatcaagggcgcgactgccgttgaggtggaactgccagatgccggcatg
cgccgcgaaatcctgatccgcctggccggccacatcgcggaaaatcatcccgccttcgtg
ctgaccgatgagatgatgcagcgtctcaactccggcatccgtggccccggccgcgagctg
accggcgcggtgtggagcctctacaccgaagcaggcttcggtgagcgggcgccaacaatg
gaaatgctggaccgcattgtccgccgtcatgccggcgagcagcgcgagccctcgatcgat
gtaatcaagcgggcgacgctgaaagtgttcccgattgccaagaccgatctggaaggcccg
agcaagatgcgcggcttcgtctacccccgtcagattgcgatgtatctctgccggacgatg
acgcggaaatccttccctcagatcggccgggcctttggcaaacgcgaccacacaacggtc
ctttacgcctatcgccgcatggatggggacatcggcaaggaccaggaactggccgcagac
attgcccgcgttcagactgtggtgcttgagctgatggaaagcggacaaatctga

DBGET integrated database retrieval system