KEGG   Hyphomonas neptunium: HNE_0584Help
Entry
HNE_0584          CDS       T00397                                 

Definition
(GenBank) hydrolase, carbon-nitrogen family
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
hne  Hyphomonas neptunium
Brite
KEGG Orthology (KO) [BR:hne00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HNE_0584
Enzymes [BR:hne01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     HNE_0584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ABI77300
UniProt: Q0C4N0
Position
583062..583898
Genome map
AA seq 278 aa AA seqDB search
MKLTAACIQMRSGTEPEANLAAATALIRQAAGQGARFIATPEMTNLLDIRPGMARPKVRT
EAQDESLPAFRALASELGITLLIGSLAIALEGEDRFANRSFLIGPDGGVLARYDKIHMFD
VEVGDGQNYRESRAYRPGETAVLAAAPFGKLGLTICYDLRFPHLHRALAKAGADILTIPA
AFTKVTGEAHWHTLVRARAIETGCFVIAPAQAGKHEDGRETFGHSLIVSPWGEVLAEGSA
TEPGIVMAEIDLADVAKARSRIPALGNEQTFSLKTFGG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcaccgccgcctgtatccagatgcgctcgggcaccgagcctgaagcaaacctc
gccgccgccaccgcgctcatccggcaggccgccgggcaaggcgcgcgcttcatcgccacg
cccgagatgacaaacctgctggacatccgccccggcatggcccgcccgaaagtgcgcaca
gaggcgcaggatgaaagcctgccggcgttccgcgcgcttgcgtcagagctcggcatcacg
ctgctcatcggctccctggcgattgcgctggaaggggaggaccgcttcgccaatcgctcc
ttccttatcgggccggacggcggcgtcctcgcccgctatgacaagatccatatgttcgat
gtcgaggttggcgacggccagaactaccgggagtcccgcgcttaccgccccggtgaaacc
gccgtgctcgccgctgcgcccttcggaaagctcggcctcaccatctgctatgatctccgc
ttcccgcatctccaccgcgcgctcgccaaggcgggcgccgacatcctcactatccccgcc
gccttcacgaaggtcaccggcgaggctcactggcatacgctggtgcgcgcccgcgccatc
gagacgggatgtttcgtgattgcgcccgcgcaggcgggtaaacacgaggacgggcgcgag
accttcggccattccctcatcgtctcgccctggggcgaggtgctggccgaaggcagcgcg
acagagccgggcatcgtgatggcggagattgacctcgcagacgtcgccaaggcgcgcagc
cgtattcctgcgctgggcaatgagcagaccttcagcctgaagacgtttggcggttag

DBGET integrated database retrieval system