KEGG   Hyphomonas neptunium: HNE_0671Help
Entry
HNE_0671          CDS       T00397                                 

Definition
(GenBank) acetyl-CoA acetyltransferases/thiolase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hne  Hyphomonas neptunium
Pathway
hne00071  Fatty acid degradation
hne00072  Synthesis and degradation of ketone bodies
hne00280  Valine, leucine and isoleucine degradation
hne00310  Lysine degradation
hne00362  Benzoate degradation
hne00380  Tryptophan metabolism
hne00620  Pyruvate metabolism
hne00630  Glyoxylate and dicarboxylate metabolism
hne00640  Propanoate metabolism
hne00650  Butanoate metabolism
hne00900  Terpenoid backbone biosynthesis
hne01100  Metabolic pathways
hne01110  Biosynthesis of secondary metabolites
hne01120  Microbial metabolism in diverse environments
hne01130  Biosynthesis of antibiotics
hne01200  Carbon metabolism
hne01212  Fatty acid metabolism
hne02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HNE_0671
   00630 Glyoxylate and dicarboxylate metabolism
    HNE_0671
   00640 Propanoate metabolism
    HNE_0671
   00650 Butanoate metabolism
    HNE_0671
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HNE_0671
   00072 Synthesis and degradation of ketone bodies
    HNE_0671
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HNE_0671
   00310 Lysine degradation
    HNE_0671
   00380 Tryptophan metabolism
    HNE_0671
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HNE_0671
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HNE_0671
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HNE_0671
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hne04147]
    HNE_0671
Enzymes [BR:hne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HNE_0671
Exosome [BR:hne04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HNE_0671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C Bacteriocin_IIc
Motif
Other DBs
NCBI-ProteinID: ABI75815
UniProt: Q0C4E3
Position
675735..676940
Genome map
AA seq 401 aa AA seqDB search
MPEAYIYDAVRTPRGKGKSSGALHEITALSLGTQVLQAIRDRNNLDTSKVDDVVFGCVSP
VGEQGGDIARIAVLNADYAETTAGVQVDRFCASGLEACNMAASKVMTGEADMAIGGGVES
MSRVPMGAAGGAWSADPQIALKSYFTPQGIGADTIATKYGFSRDDVDAFAVESQRRAAQA
WKEGRFKNSVVPVRDQMGGIRLAHDEFMRPDTTMQSLAALDPSFAGMGAMGFDEVIKQRY
PELEKINHVHHAGNSSGIVDGASAVLFGSKEMGEAMGLKPRARVRAMASIGSEPGIMLTG
PTYVTQKVLKKAGMNVGDIDIYELNEAFASVVMLMMKMLEIPHEKMNVNGGAIAMGHPLG
ATGGMILGTVLDELERSDKETGLITLCVGAGMGTATIIERI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagcctatatctacgacgccgtgcgcacgccccgcggcaaaggcaaatcctcc
ggcgcgctgcatgaaatcaccgcgctcagcctcggcacgcaggtgctgcaggccatccgt
gaccggaacaatctcgacacctccaaggtcgatgacgtggtcttcggctgcgtctcgccc
gtcggagagcagggcggcgacatcgcgcgtatcgccgtgctgaacgccgactatgctgaa
accacagccggggttcaggtcgaccgcttctgcgcgtccggcctggaggcctgcaatatg
gccgcctcgaaagtcatgaccggcgaggccgacatggccatcggcggcggcgtagaatcg
atgagccgcgtgccgatgggcgcagcgggcggggcctggtctgctgatccgcagatcgcg
ctcaaatcctactttacgccccagggtatcggcgcagacaccatcgccaccaaatacggc
ttcagccgcgatgatgtggacgccttcgccgtcgagagccagcgccgcgccgcgcaggcc
tggaaggaaggccgcttcaagaactcggttgttcccgtccgcgaccagatgggcggcatc
cgcctcgcgcatgacgaattcatgcgcccggataccaccatgcagagccttgccgcgctg
gacccgtccttcgcgggcatgggcgcgatgggctttgatgaagtcatcaagcagcgttat
cccgagcttgagaagatcaaccacgtccaccacgctggcaactcctcgggcatcgtggac
ggcgcgtctgccgttctcttcggctcgaaggaaatgggcgaggcaatgggcctcaaaccc
cgcgcccgcgtccgcgccatggcctccatcggctcggagcccggcatcatgctgaccggc
ccgacctatgtgacccagaaggtgctcaagaaagccggcatgaatgtcggcgacatcgac
atctacgaactcaacgaagcgtttgcttcggtcgtcatgctgatgatgaagatgctcgaa
atcccgcacgagaaaatgaacgtgaatggcggcgccatcgccatgggtcaccccctcggc
gcaaccggtggcatgatccttggtacggtcctggatgagcttgagcgctccgacaaggaa
accggcctcattacgctttgtgttggcgccggcatgggcaccgccacgatcatcgagcgc
atctag

DBGET integrated database retrieval system