KEGG   Hyphomonas neptunium: HNE_0893
Entry
HNE_0893          CDS       T00397                                 

Gene name
ate
Definition
(GenBank) arginyl-tRNA-protein transferase
  KO
K21420  leucyl-tRNA---protein transferase [EC:2.3.2.29]
Organism
hne  Hyphomonas neptunium
Brite
KEGG Orthology (KO) [BR:hne00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HNE_0893 (ate)
Enzymes [BR:hne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.29  aspartate/glutamate leucyltransferase
     HNE_0893 (ate)
SSDB
Motif
Pfam: ATE_C ATE_N Acetyltransf_6
Other DBs
NCBI-ProteinID: ABI78290
UniProt: Q0C3S3
Position
complement(912283..913041)
AA seq 252 aa
MKFSDPHLLPAGLERSLRFYVTNPSPCPYLPDRKERKAFTNLAIPEADALHNVLSQSGFR
RSQSIAYRPACTRCNACKSVRVATREYDISRNDRRVIARNAHLVRRPVAAQATREQFRLL
KSYVVTRHDNGGMSDMTYRDYVAMVGGSPVQSLIFEYRDGPEPDAPLVAAAITDVLRDGL
SMVYTFFDPAKTSQSLGHYLILDHIRHAHDLGLPHLYLGYWVKGSPKMDYKRRYKPLEVL
DGDRWRPLRDDE
NT seq 759 nt   +upstreamnt  +downstreamnt
atgaagttttccgatccccatcttctgccggcgggccttgagcggtcgctgaggttctac
gtgacgaaccccagcccctgcccgtatctgcctgaccggaaagagcggaaggcgtttaca
aacctcgccattcccgaagccgacgcgctgcacaatgtgctcagccagtccggtttccgc
cgcagccagtcgattgcctaccgcccggcctgcacccgctgcaatgcgtgcaagagcgtg
cgcgtggcgacgcgggagtatgacatcagccggaatgaccggcgggtgatcgcccggaac
gcccatctggtgcgccgcccggtggcagcgcaggcaacgcgcgagcagttccgcctgctc
aaatcctatgtggtgacgcgccatgacaatggcggcatgtctgacatgacctatcgcgat
tatgtggcgatggtgggcggcagccccgtgcagagcctgattttcgagtatcgtgacggg
ccggaaccggacgcgccgctggtggcagcggcgattaccgacgtgctgcgcgatggattg
tcgatggtctacaccttcttcgacccggcgaagaccagtcagagcctcggccattacctg
atcctcgaccacatccggcatgcgcatgatctgggcttgccgcatctctatctgggctat
tgggtcaagggcagcccgaagatggactacaaacggcgctacaagccgctggaagtgctt
gacggcgaccgctggcggcccttgagagacgacgagtag

DBGET integrated database retrieval system