KEGG   Hyphomonas neptunium: HNE_1792Help
Entry
HNE_1792          CDS       T00397                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hne  Hyphomonas neptunium
Pathway
hne00010  Glycolysis / Gluconeogenesis
hne00051  Fructose and mannose metabolism
hne00562  Inositol phosphate metabolism
hne01100  Metabolic pathways
hne01110  Biosynthesis of secondary metabolites
hne01120  Microbial metabolism in diverse environments
hne01130  Biosynthesis of antibiotics
hne01200  Carbon metabolism
hne01230  Biosynthesis of amino acids
Module
hne_M00002  Glycolysis, core module involving three-carbon compounds
hne_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HNE_1792 (tpiA)
   00051 Fructose and mannose metabolism
    HNE_1792 (tpiA)
   00562 Inositol phosphate metabolism
    HNE_1792 (tpiA)
Enzymes [BR:hne01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HNE_1792 (tpiA)
Exosome [BR:hne04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HNE_1792 (tpiA)
  Exosomal proteins of bladder cancer cells
   HNE_1792 (tpiA)
  Exosomal proteins of melanoma cells
   HNE_1792 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Nitro_FeMo-Co
Motif
Other DBs
NCBI-ProteinID: ABI77970
UniProt: Q0C197
Position
1837029..1837778
Genome map
AA seq 249 aa AA seqDB search
MPRTLIAGNWKMNGLMANLAEVERVAAEVPASSEGAETLLCLPATLIHAGSAKSEGSGLK
IGGETCHANEKGAHTGDLAAEMLKDAGASYVIVGHSERRADHGETDAVVAAQASAALRAG
ITPIICVGETLDQRDAGEVLTVITTQMAESIPEGAEAAAIVIAYEPVWAIGTGRVATSEQ
IAEVHTSIRNLLVRRFGDAGRTTRILYGGSMNPGNAAEILAVAEVNGGLIGGASLKAADF
LAIYRLAAQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgccacgcacgctgatcgccggaaactggaaaatgaacggtctgatggcgaatctcgcc
gaggtcgaacgggtcgccgcagaggttcccgcatcaagtgagggggctgaaacgctgtta
tgccttcctgcaacgttgattcacgcaggttcggcaaaatctgaaggatcgggcctgaaa
attggcggagaaacctgccacgccaacgaaaagggcgcccataccggcgatcttgcagca
gaaatgctcaaagatgccggcgccagctatgtcattgtggggcactcagagcgccgcgcg
gaccatggcgagacagatgccgtagtggctgcgcaggcctcggctgcattgagagcaggg
atcaccccaatcatctgcgttggcgaaacccttgaccaacgtgatgctggggaagtgctc
actgtcatcacgacgcagatggcagaatcgattcccgagggtgctgaggcagccgcaatc
gtcattgcttatgagccggtttgggccattgggaccggccgtgtcgccacttccgagcaa
attgccgaagtgcacacgtcgatccggaaccttctggtgcgccgatttggcgacgcaggg
cgcacgacccgtatcctttatggcggtagcatgaaccccggaaatgctgccgaaatcctc
gctgtggccgaggtaaatggcggcctgattgggggggcaagcttgaaggcggcggacttc
ctcgccatttaccggttggcggcgcagtag

DBGET integrated database retrieval system