KEGG   Hyphomonas neptunium: HNE_1878Help
Entry
HNE_1878          CDS       T00397                                 

Gene name
sdaA
Definition
(GenBank) L-serine ammonia-lyase
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Organism
hne  Hyphomonas neptunium
Pathway
hne00260  Glycine, serine and threonine metabolism
hne00270  Cysteine and methionine metabolism
hne01100  Metabolic pathways
hne01110  Biosynthesis of secondary metabolites
hne01130  Biosynthesis of antibiotics
hne01200  Carbon metabolism
hne01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HNE_1878 (sdaA)
   00270 Cysteine and methionine metabolism
    HNE_1878 (sdaA)
Enzymes [BR:hne01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     HNE_1878 (sdaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SDH_alpha SDH_beta
Motif
Other DBs
NCBI-ProteinID: ABI77133
UniProt: Q0C114
Position
complement(1941686..1943062)
Genome map
AA seq 458 aa AA seqDB search
MLSVLDIFRVGIGPSSSHTVGPIRIANRFMAHLASSEKLSRTARIEAELQGSLALTGVGH
ATPKAVVLGLLGLDPETLDAEEADRLVAQAYEQKVLPLPDGRKMKFDPETDIRFAYDVMP
DLHPNGLRIKAYDEGGEVIADETWYSTGGGFIATRKQLEKPVEDDILPVGDPVPFGFTSA
AQLLELCQTNGLGIYEVILANEDAKRPREKTEAALDRIAAVMMACIDRGLMRKGELPGGL
KVRRRAPEIWQKLQEGPPSNEREQLFDWLNVYAMAVNEENAAGGQVVTAPTNGAAGIIPS
VIRHYCADTEDAPERMRKFLLTAGGIGLLYKQRASISGAEMGCQGEVGVACSMAAGGLAA
VWGGTPQQVANAAEIGMEHNLGLTCDPVGGLVQIPCIERNAIGAVKAANAARLALHSLEQ
TKVSLDQVIETMRQTGLDMSSKYKETSQGGLAVNVIEC
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcggtattggatatttttcgggttggcattgggccttcgagttcgcacacggtg
ggtccgatccgcattgcaaaccggttcatggcgcatctggccagttcggaaaagctatcg
cgaacggcacggattgaggcagagttgcaggggtcactcgcgctgacgggtgtggggcac
gcgacgcccaaagccgtggtgctgggtctgctggggctcgaccctgaaacgctggatgcg
gaggaagcagaccggctggtcgcgcaagcgtatgagcagaaggtgctgccattgcccgat
ggccggaagatgaaattcgatccggagacggatattcggtttgcctatgatgtcatgcca
gacctgcacccgaacgggcttcggatcaaggcatatgacgaaggcggcgaagtgattgcc
gacgagacgtggtattccacgggaggcggatttatcgcgacgcgcaaacagctggaaaag
cctgtcgaggatgacattctgccggtgggggaccctgtgccgtttggttttacctcggct
gctcaattgctggaactctgccagacaaatggcctcggcatttatgaggtcatcctggcg
aatgaagacgccaaacggccacgcgagaaaacagaagccgcgctggaccggattgcggcg
gtgatgatggcttgcattgatcgtggattgatgcggaagggggagctgccgggcggcttg
aaggttcgccgccgcgccccggagatctggcagaaattgcaggagggcccgccctccaat
gagcgcgagcagttgttcgattggctgaatgtttatgccatggctgtgaatgaagaaaac
gctgcgggcgggcaggtggtgacggcgccaacaaatggcgcggccggtatcataccgtcc
gtaatccggcattattgtgccgataccgaagacgcgccggagcgtatgcggaagtttctg
ctgaccgccggcgggattgggctgctttacaagcagcgggcgtcaatttcgggcgctgag
atgggatgccagggtgaggtgggggtcgcttgctcgatggcggcgggcggtcttgcggcg
gtttggggcggcacgccacaacaggtggctaatgcggcggagatcgggatggagcacaat
ctggggcttacctgcgatcctgtaggcggccttgtgcaaattccctgtattgagcggaac
gcgattggcgccgtgaaagcggccaatgctgcccgcctggcgctgcattccctcgaacag
acgaaagtctctctggatcaggttatcgagacgatgcggcagaccggattggacatgtca
tccaaatataaggagaccagccagggcggtctcgcggtcaatgtgatcgaatgctag

DBGET integrated database retrieval system