KEGG   Hyphomonas neptunium: HNE_1928Help
Entry
HNE_1928          CDS       T00397                                 

Gene name
pcm
Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hne  Hyphomonas neptunium
Brite
Enzymes [BR:hne01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HNE_1928 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_31 Methyltr_RsmB-F MTS
Motif
Other DBs
NCBI-ProteinID: ABI78433
UniProt: Q0C0W4
Position
complement(1998332..1998991)
Genome map
AA seq 219 aa AA seqDB search
MAELIADPFRAARLLLSLRQEGVTDPSVLAAMETIGRAAFVDDAGLEALSFEDSIIPIPC
GQVMLRPSATGHLIQAMGLKRGQEGRVLLIGFGSGYMAALLSQLAAHVFAVERFARLTEE
GRVRLARLGVENVTLSHRDGLHGWAEQGPFDAIVLAGAVPAVPEGLTAQLTRGGVLVAPI
NEGAGQANLLRVTASGSELDRRPLFQWVPPLIEGRAQVL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcagagctgatcgctgatcccttccgcgccgcgcggctgctgctctcgctgaggcag
gagggggtgactgatcccagcgttctggcggccatggaaacgatcggccgggcggcgttt
gtggacgatgccgggcttgaggcgctttccttcgaagattcgatcatcccgataccttgt
ggccaggtgatgttgcgcccctcggcgacggggcatctgatccaggccatgggattgaag
cgcggccaggaagggcgcgtgctgctgatcggttttggttcgggctatatggcggcgctg
ctctcccagcttgccgcgcatgtgtttgcggtcgagcgctttgcccgtctgacggaagag
gggcgggtccggctcgcgcggcttggcgtggagaatgtgacgctgtcccatcgtgatggc
ctgcatggatgggccgagcagggcccatttgacgcgatcgtgctggcgggcgccgttccc
gccgtcccggaagggctgaccgcgcagttgacgcggggcggggtgctggtggcccccatc
aatgagggggctgggcaggcgaatcttttgcgcgtgactgcctcgggaagcgagctggac
agacggccgctgtttcaatgggtgccgccgcttatcgagggacgcgcgcaagtgctttga

DBGET integrated database retrieval system