KEGG   Hyphomonas neptunium: HNE_1962Help
Entry
HNE_1962          CDS       T00397                                 

Gene name
groL
Definition
(GenBank) chaperonin GroEL
  KO
K04077  chaperonin GroEL
Organism
hne  Hyphomonas neptunium
Pathway
hne03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hne00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    HNE_1962 (groL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hne03019]
    HNE_1962 (groL)
   03110 Chaperones and folding catalysts [BR:hne03110]
    HNE_1962 (groL)
   03029 Mitochondrial biogenesis [BR:hne03029]
    HNE_1962 (groL)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hne04147]
    HNE_1962 (groL)
Messenger RNA biogenesis [BR:hne03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     HNE_1962 (groL)
Chaperones and folding catalysts [BR:hne03110]
 Heat shock proteins
  HSP60 / Chaperonin
   HNE_1962 (groL)
Mitochondrial biogenesis [BR:hne03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    HNE_1962 (groL)
Exosome [BR:hne04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HNE_1962 (groL)
  Exosomal proteins of other body fluids (saliva and urine)
   HNE_1962 (groL)
  Exosomal proteins of breast cancer cells
   HNE_1962 (groL)
  Exosomal proteins of colorectal cancer cells
   HNE_1962 (groL)
  Exosomal proteins of bladder cancer cells
   HNE_1962 (groL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn60_TCP1 DUF3776
Motif
Other DBs
NCBI-ProteinID: ABI78727
UniProt: Q0C0T0
Position
2031071..2032714
Genome map
AA seq 547 aa AA seqDB search
MAAKHVVFGAEARERMLRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRSTKDGVTVAKEI
ELEDKFENMGAQMLREVASKANDTAGDGTTTATVLAQAIVREGMKRVAAGMNPMDLKRGI
SKAVAEVVSDLAHHSKKVKTNEEIAQVGTISANGETEIGQMIAEAMAKVGNEGVITVEEA
KALETELDVVEGMQFDRGYISPYFITNPDKMIVELEDVLILLHESKLSSLQPLLPILESV
VQSQKPLLIIAEDVDGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDLAVLTGGQV
ISEDLGIKLENVGMEMLGKAKRVSIDKDNTTIVDGGGKKKEIEARVSQIRKQIDDTSSDY
DREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALNATRAAVEEGIVPGGGVALL
RSSKNIDVVGLNDDEKAGIDIVRKALEAPIRQIAENAGVEGSVVVNTILNNKSRSYGFNA
QTEEYGDLVAMGVIDPVKVVRSALQNAASIASLLITTEAGIAEAPKKESAGGGGMPGGMG
GMGGMDF
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaaacacgttgttttcggcgccgaagcccgcgagcggatgctccgcggcgtc
gacaccctcgcgaatgctgtgaaggtcacactcggccctaaaggccgtaacgtggtcatc
gaaaaatcgttcggcgctccgcgctccacgaaagatggcgtcaccgtcgcgaaagaaatc
gaactggaagacaagttcgaaaatatgggcgcccagatgctgcgcgaagtcgcatcgaag
gccaatgacaccgccggtgacggcaccaccactgccaccgtgctcgctcaggccatcgtt
cgcgaaggcatgaagcgcgttgccgccggcatgaacccgatggaccttaagcgcggcatc
tcgaaggccgttgctgaagtcgtttccgacctcgctcatcactccaagaaagtgaagacg
aacgaagagatcgcccaggtcggcaccatctcggccaacggcgaaaccgaaatcggccag
atgatcgctgaagccatggcgaaagtcggcaacgaaggcgtcatcacggttgaagaagcc
aaagcgctggaaaccgaactcgatgtcgtcgaaggcatgcagttcgaccgcggctatatc
agcccgtacttcatcaccaacccggacaagatgatcgttgaactcgaagacgttctgatc
ctcctgcacgagtcgaagctgtcgagcctccagccgctgcttccgatcctcgaatcggtt
gttcagtcgcagaagccgctgctcatcatcgctgaagacgttgatggcgaagccctcgca
actctggtggtcaacaagctgcgtggcggcctgaaaatcgctgctgtgaaagctcctggc
ttcggcgatcgccgcaaagccatgctgcaggacctcgccgtccttaccggtggtcaggtc
atctctgaagacctcggcatcaagcttgaaaacgtcggcatggaaatgctcggcaaagcc
aaacgcgtctcgatcgacaaagacaacaccacgatcgttgatggcggcggcaagaagaaa
gagatcgaagcgcgcgtttcgcaaatccgcaagcagatcgatgacacctcttccgactat
gaccgtgagaagctccaggagcgtctcgcgaaactggccggcggcgttgccgttatcaaa
gttggcggcgcaaccgaagtcgaagtgaaagagcgtaaggaccgcgtcgacgacgccctg
aacgcaacgcgcgcggctgtcgaagaaggcatcgtgccaggtggcggcgttgccctgctc
cgttcttccaagaacatcgacgttgttggtctcaacgacgacgaaaaagccggcatcgac
atcgttcgcaaggcactcgaagctccgatccgtcagatcgcagagaacgcaggcgttgaa
ggctcggtggtcgtcaacacgatcctgaacaacaagtcgcgctcttacggcttcaacgct
cagactgaagagtatggcgatctcgtcgctatgggcgttatcgaccccgtgaaggtcgtc
cgctcggctctgcagaacgcggcctcgatcgccagcctgctgatcacgacggaagccggc
attgccgaagctccgaagaaagagtcagccggcggcggtggcatgcccggcggtatgggt
ggcatgggcggtatggacttctaa

DBGET integrated database retrieval system