KEGG   Hyphomonas neptunium: HNE_2272Help
Entry
HNE_2272          CDS       T00397                                 

Definition
(GenBank) putative DNA polymerase III chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
hne  Hyphomonas neptunium
Pathway
hne00230  Purine metabolism
hne00240  Pyrimidine metabolism
hne01100  Metabolic pathways
hne03030  DNA replication
hne03430  Mismatch repair
hne03440  Homologous recombination
Module
hne_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HNE_2272
   00240 Pyrimidine metabolism
    HNE_2272
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    HNE_2272
   03430 Mismatch repair
    HNE_2272
   03440 Homologous recombination
    HNE_2272
Enzymes [BR:hne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     HNE_2272
DNA replication proteins [BR:hne03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     HNE_2272
DNA repair and recombination proteins [BR:hne03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     HNE_2272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: ABI76442
UniProt: Q0BZX6
Position
complement(2372760..2373230)
Genome map
AA seq 156 aa AA seqDB search
MQPAAPEWWFYHLSRSALEEAAAPLLQKCLEVGWRVLAVSPRAERLAKLDAVLWTFDDAS
FLPHGQADAPGLDVARQPVLLSAKLTNANSADALMLMDGVEAPVDVAFKRCMVMFEDADT
GTRNKARAQFKAAKDAGLTTRYFQQTERGGWKEAGV
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcagccagcagcccccgaatggtggttctaccatctctcgcgcagcgcgctggaggag
gccgccgcgccgctcctgcagaaatgcctcgaagtcggctggcgcgtgctcgccgtgtct
ccgcgtgcggagcgtctggcaaagctcgacgccgtgctctggaccttcgacgacgcctcc
ttcctgccgcatggccaggccgatgcgccgggtctggatgtcgcccgccagccagtgctg
ctgtcggcaaagctcaccaacgccaacagcgccgatgccctgatgctgatggacggcgtg
gaggcgccggtggacgtggccttcaagcgctgcatggtgatgttcgaagacgccgacacc
ggcacccgcaacaaggcgcgcgcccagttcaaggccgcaaaagatgccggcctcaccacc
cgctattttcagcagacggaacgtggcggctggaaagaggcgggggtttaa

DBGET integrated database retrieval system