KEGG   Hyphomonas neptunium: HNE_2620Help
Entry
HNE_2620          CDS       T00397                                 

Definition
(GenBank) class-V pyridoxal-phosphate-dependent aminotransferase, NifS/IscS family
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
hne  Hyphomonas neptunium
Pathway
hne00730  Thiamine metabolism
hne01100  Metabolic pathways
hne04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:hne00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    HNE_2620
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    HNE_2620
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hne03016]
    HNE_2620
   03029 Mitochondrial biogenesis [BR:hne03029]
    HNE_2620
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:hne02048]
    HNE_2620
Enzymes [BR:hne01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     HNE_2620
Transfer RNA biogenesis [BR:hne03016]
 Eukaryotic type
  tRNA modification factors
   Thiolation factors
    HNE_2620
 Prokaryotic type
    HNE_2620
Mitochondrial biogenesis [BR:hne03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    HNE_2620
Prokaryotic defense system [BR:hne02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   HNE_2620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ABI75823
UniProt: Q0BYY4
Position
complement(2777912..2779114)
Genome map
AA seq 400 aa AA seqDB search
MQIFLQGAGLIERLYIREVMIYADYNATAPLRPEARAAMLAAYELGPVNPSSVHKAGRAA
RAVVEKARAEVGAAIGSRAEDIVFTSGGTESLALAIQGAVAGLDGAATLIVSAIEHEAAS
KAAAHAGVPVETAYILPTGQVDLDDLRVRLAAWDRGLKGTPILVLMLANNETGILQPVAE
AAALIREAGGLTVCDAVQGLGKVAVNVALLGVDYLALSAHKVGGPQGTGALWHRAGAPLK
AVLYGGGQERGLRSGTENVAGIAGFGAAMSQAVLDLSRYVSLGTHRDAMEARLKAEGGVI
VIGEGSPRLAGVSNFARAGFRAETQVMALDLAGVCISAGSACSSGKVKRSLVLMAMGADD
ALAESAIRTSFGWNSRPEDFRHVADAWLEAARRTVLKESV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatttttctgcagggtgcgggattgatcgaaaggctctatattagagaggtcatg
atttatgctgattacaacgccaccgccccgctgcggccagaggccagggcggccatgctg
gcggcctatgagctggggccggtgaacccctcctccgtccacaaggccgggcgggctgcg
cgcgccgtcgtcgaaaaggcccgtgccgaggtcggcgccgccatcggcagccgcgccgaa
gacatcgtcttcaccagcgggggcaccgaatccctcgccctcgccatccagggcgctgtg
gccgggctcgacggggcggcgacgcttattgtgtccgccatcgagcatgaagccgccagc
aaggctgccgcccatgccggcgtaccggtcgagaccgcctacatccttcccaccggccag
gtggacctggacgatctccgcgtccgcctcgcggcatgggaccggggcctcaaaggcacc
cccattctcgtgctgatgctggccaacaacgaaaccggcatcctccagcccgtggctgag
gctgccgcgctgatacgcgaggccggcgggctgaccgtgtgtgacgcggttcagggcctc
ggcaaggtggcggtgaatgtcgcgctgctgggcgtcgattaccttgcgctttccgcccac
aaggtcggcggcccgcagggcaccggcgcgctgtggcaccgggcgggcgcgccgctgaaa
gccgtgctttatggcggcgggcaggaacggggcctgcgctcgggcaccgagaatgtcgcc
gggattgccgggtttggcgcggcgatgtcccaagctgtcctggatttgtcccgatatgtc
tcgctgggaacccaccgtgacgcgatggaggcccgcctgaaggccgaaggcggcgtcatt
gtcataggcgagggcagcccccgtctcgccggggtctcaaacttcgcccgcgccggtttc
cgcgccgaaacccaggtgatggcccttgatctggcgggggtttgcatctcggcaggctcg
gcctgctcgtcgggcaaggtgaaaagatcccttgtgctgatggccatgggcgcagatgac
gcccttgcggaatcggcgatccgcaccagctttggctggaacagccgcccggaagatttc
cgccacgtcgccgacgcctggctggaggctgcccggagaactgtgttgaaggaatccgta
tga

DBGET integrated database retrieval system