KEGG   Hyphomonas neptunium: HNE_2671Help
Entry
HNE_2671          CDS       T00397                                 

Gene name
apaG
Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
hne  Hyphomonas neptunium
Brite
KEGG Orthology (KO) [BR:hne00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    HNE_2671 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ABI77578
UniProt: Q0BYU0
Position
complement(2832120..2832536)
Genome map
AA seq 138 aa AA seqDB search
MARRPAPPQYEAITDGVRIRVRPKFLHDESEPTRAKFMWQYTVEVENESDRTWTIIRRHW
RIVDSAGRLQAVDGEGVIGQTPTVGPGQRFSYTSGAPLATPSGMMTGTYDLVDDAGEEMV
AMIPAFSLDSPYDTSRPS
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggcaagacgccccgctcctccacagtatgaggccatcaccgatggcgtgcgcattcgt
gtgcgccccaaattcctgcacgacgaatccgagccgacgcgggccaagttcatgtggcag
tatacggtggaggtcgagaatgagagcgaccggacctggaccatcatccgccggcattgg
cggatcgtggattcggccgggcggcttcaggcggtcgatggcgaaggcgtgatcgggcag
acgccgacggtcgggccggggcagcgtttcagctatacatccggcgcgccgctggcgacg
ccttcgggcatgatgacgggcacctatgacctcgtcgatgacgcgggcgaagagatggtg
gcgatgatccccgccttctcgctcgacagcccgtacgatacgtcgcggccgagctga

DBGET integrated database retrieval system