KEGG   Hyphomonas neptunium: HNE_2777Help
Entry
HNE_2777          CDS       T00397                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
hne  Hyphomonas neptunium
Pathway
hne00071  Fatty acid degradation
hne00280  Valine, leucine and isoleucine degradation
hne00281  Geraniol degradation
hne00310  Lysine degradation
hne00360  Phenylalanine metabolism
hne00362  Benzoate degradation
hne00380  Tryptophan metabolism
hne00410  beta-Alanine metabolism
hne00627  Aminobenzoate degradation
hne00640  Propanoate metabolism
hne00650  Butanoate metabolism
hne00903  Limonene and pinene degradation
hne00930  Caprolactam degradation
hne01100  Metabolic pathways
hne01110  Biosynthesis of secondary metabolites
hne01120  Microbial metabolism in diverse environments
hne01130  Biosynthesis of antibiotics
hne01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:hne00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    HNE_2777
   00650 Butanoate metabolism
    HNE_2777
  Lipid metabolism
   00071 Fatty acid degradation
    HNE_2777
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HNE_2777
   00310 Lysine degradation
    HNE_2777
   00360 Phenylalanine metabolism
    HNE_2777
   00380 Tryptophan metabolism
    HNE_2777
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HNE_2777
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HNE_2777
   00281 Geraniol degradation
    HNE_2777
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HNE_2777
   00627 Aminobenzoate degradation
    HNE_2777
   00930 Caprolactam degradation
    HNE_2777
Enzymes [BR:hne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     HNE_2777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 CLP_protease
Motif
Other DBs
NCBI-ProteinID: ABI77558
UniProt: Q0BYI7
Position
complement(2941194..2941862)
Genome map
AA seq 222 aa AA seqDB search
MTATVKIENEIAVVTMDDGKANAISLTMLEAVNAALDEAETAAKVIVLAGRPERFSAGFD
LKFLASSEPDQVRKLVMGGGKLAFRLFTSDKPVVIACTGHAIAMGAFILLAGDTRIAARG
AYKIGANETVNGMTLPGFGVELPRARLNPMYLTQALAQAKLYTPDEALPVGWVDQVVEPG
EVLGAAMAEAERLLPIANYAYGRNKKYARQPAIDLIAPTLEI
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccaccgtgaaaatcgagaatgagattgctgtcgtcactatggatgatggcaag
gccaacgccatcagcctgacgatgctggaagcggtgaacgcggcgctggacgaggcggag
acggcggcgaaggtgatcgtgctggccgggcggccggagcggttttcggcagggtttgac
ctgaagtttctcgcttcatccgagcccgatcaggtgcgcaagctggtgatgggcgggggc
aagctggcgttccggctgtttacctctgacaagccggtcgtcattgcgtgtacgggacat
gccattgccatgggggcgttcatcctgctggccggggatacgcggattgcggcgcggggc
gcctacaagatcggcgcgaatgagacggtgaacggcatgacgctgccaggcttcggggtg
gagctgccgcgggcgaggctcaacccgatgtatctgacgcaggcgctggcgcaggcgaag
ctctacacgcccgatgaagcgctgcccgtgggctgggtggaccaggtggtggagccgggc
gaagtgctgggcgcggcgatggcggaggccgagcggctgctcccgattgccaactacgct
tatggccggaacaagaagtatgcccgccagccggcaattgatctgattgcgccgacgctc
gaaatttag

DBGET integrated database retrieval system