KEGG   Hyphomonas neptunium: HNE_2846Help
Entry
HNE_2846          CDS       T00397                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
hne  Hyphomonas neptunium
Pathway
hne03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hne00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HNE_2846 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hne03011]
    HNE_2846 (rplV)
Ribosome [BR:hne03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    HNE_2846 (rplV)
  Bacteria
    HNE_2846 (rplV)
  Archaea
    HNE_2846 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ABI78049
UniProt: Q0BYB9
Position
complement(3000505..3000894)
Genome map
AA seq 129 aa AA seqDB search
MAKAKNPPKQEAHESRAVLRMYRSSPQKLNLLAQQIRGMPIQRALNEMKFSPKRPAKDVY
KLLQSAVANAENNHGLDIDSLVVAEAHVGKNLVMKRIRARARGRAARIVKPFSQLTIVLR
DTSQTAEAA
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggccaagaatcctcccaagcaggaagcgcatgaatcgcgcgccgtgctgcgc
atgtaccgctcgagccctcagaagctgaaccttctggcgcagcagatccgtggcatgccg
atccagcgcgcgctcaacgagatgaaattctcgcccaagcgccctgcgaaagacgtctac
aagctccttcagagcgccgttgcgaacgccgagaacaatcacggcctcgacatcgacagc
ctggtcgttgctgaagcacatgtcggcaagaacctcgtcatgaagcgcatccgcgcccgt
gcgcgtggccgcgctgcccgcatcgtgaagccgttctcgcaactcaccattgtcctgcgt
gacaccagccagactgcggaggccgcataa

DBGET integrated database retrieval system