KEGG   Hyphomonas neptunium: HNE_3442
Entry
HNE_3442          CDS       T00397                                 

Gene name
rpsO
Definition
(GenBank) ribosomal protein S15
  KO
K02956  small subunit ribosomal protein S15
Organism
hne  Hyphomonas neptunium
Pathway
hne03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hne00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HNE_3442 (rpsO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hne03011]
    HNE_3442 (rpsO)
Ribosome [BR:hne03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    HNE_3442 (rpsO)
  Bacteria
    HNE_3442 (rpsO)
  Archaea
    HNE_3442 (rpsO)
SSDB
Motif
Pfam: Ribosomal_S15 STIL_N
Other DBs
NCBI-ProteinID: ABI75756
UniProt: Q0BWM8
Position
complement(3581768..3582037)
AA seq 89 aa
MSITAERKQELIKKFAIKEGDTGSPEVQVAILTERINNLTDHFKTNKKDNHSRRGLLTMV
ATRRKLLDYARSKSEARYTKLITELGIRR
NT seq 270 nt   +upstreamnt  +downstreamnt
atgtcgattactgctgaaagaaagcaggagctcatcaagaaattcgccattaaagaaggc
gatacgggctctccagaagtgcaggttgcgatcctcaccgagcggatcaacaacctgacc
gaccacttcaagaccaacaaaaaagacaaccactcccgccgcggcctcctgactatggtc
gccacgcgccggaagctcctggattatgcgcggagcaaaagtgaagcgcgttacacgaag
ctgatcacggaactcggcatccgccgctag

DBGET integrated database retrieval system