KEGG   Hyphomicrobium nitrativorans: W911_02145Help
Entry
W911_02145        CDS       T02943                                 

Definition
(GenBank) ApaG
  KO
K06195  ApaG protein
Organism
hni  Hyphomicrobium nitrativorans
Brite
KEGG Orthology (KO) [BR:hni00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    W911_02145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 LTD
Motif
Other DBs
NCBI-ProteinID: AHB47475
UniProt: V5SBR2
Position
complement(463355..463762)
Genome map
AA seq 135 aa AA seqDB search
MTDETPYEQVTEGVRIRVTPEFSEDQSTEEESYFFWIYTIEIANESAHTVQLKSRIWRIT
DDTGKTDEVRGPGVVGQTPVIPPGQSFTYSSGCPLGTPSGIMVGSYQMIDETGRLFDVAI
PAFSLDSPYASRSVN
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgagaccccatacgagcaggtaaccgaaggcgtccgcatccgcgtcacgccc
gaattctcggaagatcagtcgacagaagaagaaagctacttcttctggatttacacgatc
gagatcgccaacgagagcgcacacaccgtccagctcaaaagccgcatctggcgcatcacc
gacgacaccggaaaaacggacgaagtgcgcgggcccggcgtcgtcgggcagacgcccgtc
atcccaccgggccagtcgtttacatattcctcgggctgtccgctcggcacgccatcgggt
atcatggtcggcagttatcagatgatcgacgagacgggccggttgttcgacgtcgcgatt
cccgcgttttcgctcgacagcccttacgcctcgcgcagcgtgaactga

DBGET integrated database retrieval system