KEGG   Hyphomicrobium nitrativorans: W911_03765Help
Entry
W911_03765        CDS       T02943                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
hni  Hyphomicrobium nitrativorans
Pathway
hni00270  Cysteine and methionine metabolism
hni00480  Glutathione metabolism
hni01100  Metabolic pathways
Module
hni_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:hni00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    W911_03765
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    W911_03765
Enzymes [BR:hni01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     W911_03765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AHB47717
UniProt: V5SB47
Position
complement(796406..797359)
Genome map
AA seq 317 aa AA seqDB search
MPLRIACQMDPIERIDIRGDSTFAILLEAERRGHEIFYYTPQNLALDGRDLMATGHALSV
VDKIGDHYRLGRASRENLAEWDVVLLRQDPPFDMAYITTTHLLERIHPKTLVVNDPAHVR
NAPEKIFVLDFLDLMPATLVTRSLDDVLAFRRAHKDIILKPLYGNGGASVFRVAPDDTNL
GSLVELFQTVFREPFMVQEYRPEVRGGDKRIILVDGEVAGAINRVPPAGETRSNLHVGGT
AHRTDLTEREREICARLAPELKARGLIFTGIDVIGGYLTEINVTSPTGIRQVKDFGGADI
ASLIWDAIENKVAQKAR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcccctccgcattgcctgccagatggaccccatcgagcggatcgacattcgcggcgac
agcaccttcgcgatcctgctcgaagcggaacgccgcggccatgagatcttctattatacg
ccacagaacctcgcgctcgacggccgcgatctgatggccacaggccacgcgttgagcgtg
gtcgacaaaatcggcgatcactatcgcctcggccgggcaagccgcgaaaacctcgcggag
tgggacgtggtgctgctgcgccaggatccgcccttcgacatggcctacatcacgaccacg
catctcctggagcgcatccacccgaagacgctcgtcgtcaacgaccccgcgcacgtgcgc
aacgcgcccgagaaaatcttcgtcctcgacttcctggacctgatgccggcgaccctcgtc
acgcgctcgcttgacgatgtgctggccttccgccgcgcgcacaaggacatcattctgaag
ccgctctacggcaacggcggcgcgagcgtgttccgcgttgcacccgacgacacgaacctc
ggctccctggtcgagctgttccagaccgtgttccgcgaaccgttcatggtgcaggaatac
cggcccgaggtgcgcggcggcgacaagcgcatcatcctggtggacggcgaggtggcgggc
gcaatcaaccgcgtgccgccagcgggcgaaacgcgctccaatctgcacgtcggcgggacg
gcgcaccgcaccgatctcaccgagcgcgaacgcgagatctgcgcgcgcctcgcccccgag
ctcaaggcccgcggcctcatcttcaccggcatcgacgtcatcggcggctatcttaccgag
atcaacgttacgtctcccacgggcatccgccaggtgaaagacttcggcggcgccgatatc
gcttcgctcatatgggatgccatcgagaacaaggtcgcgcagaaagcgcgctga

DBGET integrated database retrieval system